| UniProt ID | BMP6_HUMAN | |
|---|---|---|
| UniProt AC | P22004 | |
| Protein Name | Bone morphogenetic protein 6 | |
| Gene Name | BMP6 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 513 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Induces cartilage and bone formation.. | |
| Protein Sequence | MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLPRGEPPPGRLKSAPLFMLDLYNALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAHPLNRKSLLAPGSGSGGASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRDGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 59 | Phosphorylation | RTEQPPPSPQSSSGF CCCCCCCCCCCCCCH | 41.15 | 26074081 | |
| 62 | Phosphorylation | QPPPSPQSSSGFLYR CCCCCCCCCCCHHHH | 29.83 | 26074081 | |
| 63 | Phosphorylation | PPPSPQSSSGFLYRR CCCCCCCCCCHHHHH | 29.27 | 26074081 | |
| 64 | Phosphorylation | PPSPQSSSGFLYRRL CCCCCCCCCHHHHHH | 38.52 | 26074081 | |
| 68 | Phosphorylation | QSSSGFLYRRLKTQE CCCCCHHHHHHHHHH | 7.45 | 26074081 | |
| 73 | Phosphorylation | FLYRRLKTQEKREMQ HHHHHHHHHHHHHHH | 46.69 | 26074081 | |
| 241 | N-linked_Glycosylation | HHKEFKFNLSQIPEG CCHHEECCHHHCCCC | 39.10 | UniProtKB CARBOHYD | |
| 269 | N-linked_Glycosylation | CVMGSFKNQTFLISI CCCCCCCCCCHHHHH | 44.08 | UniProtKB CARBOHYD | |
| 386 | N-linked_Glycosylation | RRRQQSRNRSTQSQD HHHHHHCCCCCHHHH | 47.72 | UniProtKB CARBOHYD | |
| 398 | O-linked_Glycosylation | SQDVARVSSASDYNS HHHHHHHHCCCCCCH | 18.03 | 55835385 | |
| 404 | N-linked_Glycosylation | VSSASDYNSSELKTA HHCCCCCCHHHHHHH | 44.01 | UniProtKB CARBOHYD | |
| 409 | Ubiquitination | DYNSSELKTACRKHE CCCHHHHHHHHHHCC | 29.99 | - | |
| 454 | N-linked_Glycosylation | FPLNAHMNATNHAIV CCCCCCCCCCCHHHH | 33.47 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BMP6_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BMP6_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BMP6_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of BMP6_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
