dbPTM

BH049_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BH049_ARATH
UniProt AC	Q9CAA9
Protein Name	Transcription factor bHLH49
Gene Name	BHLH49
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	486
Subcellular Localization	Nucleus .
Protein Description	Transcriptional activator involved in cell elongation. Regulates the expression of a subset of genes involved in cell expansion by binding to the G-box motif..
Protein Sequence	MDLSAKDEFSAEKRNPDNYDSVNNPSGDWRVDSYPSENLISAGPASCSPSQMMDSFGQTLWYDPTSVQAVGYAGFNGGNASSSSFRGSIDRSLEMGWNLPNLLPPKGNGLFLPNASSFLPPSMAQFPADSGFIERAARFSLFSGGNFSDMVNQPLGNSEAIGLFLQGGGTMQGQCQSNELNVGEPHNDVSVAVKESTVRSSEQAKPNVPGSGNVSEDTQSSGGNGQKGRETSSNTKKRKRNGQKNSEAAQSHRSQQSEEEPDNNGDEKRNDEQSPNSPGKKSNSGKQQGKQSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNLEGLLAKDALQLRAGSSSTTPFPPNMSMAYPPLPHGFMQQTLSSIGRTITSPLSPMNGGFKRQETNGWEGDLQNVIHINYGAGDVTPDPQAAATASLPAANMKVEP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
277	Phosphorylation	NDEQSPNSPGKKSNS CCCCCCCCCCCCCCC	38.11	25561503
428	Phosphorylation	TLSSIGRTITSPLSP HHHHHCCCCCCCCCC	24.32	28295753
430	Phosphorylation	SSIGRTITSPLSPMN HHHCCCCCCCCCCCC	24.55	28295753
431	Phosphorylation	SIGRTITSPLSPMNG HHCCCCCCCCCCCCC	21.72	28295753
434	Phosphorylation	RTITSPLSPMNGGFK CCCCCCCCCCCCCCC	26.03	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BH049_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BH049_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BH049_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of BH049_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BH049_ARATH

Related Literatures of Post-Translational Modification