dbPTM

BGL2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BGL2_SCHPO
UniProt AC	O13990
Protein Name	Glucan 1,3-beta-glucosidase
Gene Name	bgl2
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	321
Subcellular Localization	Secreted, cell wall. Tightly bound to cell wall..
Protein Description	Glucanases possibly play a role in cell expansion during growth, in cell-cell fusion during mating, and in spore release during sporulation. This enzyme may be involved in beta-glucan degradation and also function biosynthetically as a transglycosylase..
Protein Sequence	MQFLSSFVFAALALLPLSAMAVDEAASEIASSTKPASTNGTLSFCLGVKHADGTCKYTDDYLADFEVLAPYTNMIRTYATSDCNTLEYLLPALAQSPYNFSAILGVWPTDDAHYDLEKQALMQYLPQYGVDHVRAITVGSEVLYRNDLPADVLAERIYDVRGLVQQKLGFDVPVGTADSWNLWAGGSGDVVITASDFIMSNDFPYWQGQNTSNMTNTFISDTLAALERVQSVKGTNNVTFWVGETGWPTDGPSYGEADATVDIASEFFQEALCNIRRKGIDIFFFEAFDEDWKGDSSSVEPYFGAMYSNRTLKYNLNCTSE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
39	N-linked_Glycosylation	STKPASTNGTLSFCL CCCCCCCCCEEEEEE	38.67	-
99	N-linked_Glycosylation	ALAQSPYNFSAILGV HHHCCCCCHHHEEEE	27.99	-
210	N-linked_Glycosylation	FPYWQGQNTSNMTNT CCCCCCCCCCCCCCH	52.91	-
213	N-linked_Glycosylation	WQGQNTSNMTNTFIS CCCCCCCCCCCHHHH	38.98	-
237	N-linked_Glycosylation	QSVKGTNNVTFWVGE HHCCCCCCEEEEEEC	33.76	-
309	N-linked_Glycosylation	YFGAMYSNRTLKYNL CCCEECCCCEEEEEC	24.38	-
317	N-linked_Glycosylation	RTLKYNLNCTSE--- CEEEEECCCCCC---	24.31	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BGL2_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BGL2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BGL2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of BGL2_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BGL2_SCHPO

Related Literatures of Post-Translational Modification