BGL26_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BGL26_ARATH
• UniProt AC: O64883
• Protein Name: Beta-glucosidase 26, peroxisomal
• Gene Name: BGLU26
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 560
• Subcellular Localization: Peroxisome .
• Protein Description: Possesses beta-glucosidase activity toward 4-methyl-umbelliferyl-beta-D-glucoside in vitro. Possesses myrosinase activity toward indol-3-yl-methylglucosinolate (I3M) and 4-methoxy-indol-3-yl-methylglucosinolate (4MO-I3M) in vivo. [PubMed: 19095900 Component of an inducible preinvasion resistance mechanism that prevents penetration of the nonhost fungal species B.graminis and E.pisi]
• Protein Sequence: MAHLQRTFPTEMSKGRASFPKGFLFGTASSSYQYEGAVNEGARGQSVWDHFSNRFPHRISDSSDGNVAVDFYHRYKEDIKRMKDINMDSFRLSIAWPRVLPYGKRDRGVSEEGIKFYNDVIDELLANEITPLVTIFHWDIPQDLEDEYGGFLSEQIIDDFRDYASLCFERFGDRVSLWCTMNEPWVYSVAGYDTGRKAPGRCSKYVNGASVAGMSGYEAYIVSHNMLLAHAEAVEVFRKCDHIKNGQIGIAHNPLWYEPYDPSDPDDVEGCNRAMDFMLGWHQHPTACGDYPETMKKSVGDRLPSFTPEQSKKLIGSCDYVGINYYSSLFVKSIKHVDPTQPTWRTDQGVDWMKTNIDGKQIAKQGGSEWSFTYPTGLRNILKYVKKTYGNPPILITENGYGEVAEQSQSLYMYNPSIDTERLEYIEGHIHAIHQAIHEDGVRVEGYYVWSLLDNFEWNSGYGVRYGLYYIDYKDGLRRYPKMSALWLKEFLRFDQEDDSSTSKKEEKKESYGKQLLHSVQDSQFVHSIKDSGALPAVLGSLFVVSATVGTSLFFKGANN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
176	Phosphorylation	ERFGDRVSLWCTMNE HHHCCEEEEEEECCC	19.62	28295753
180	Phosphorylation	DRVSLWCTMNEPWVY CEEEEEEECCCCEEE	16.08	28295753
187	Phosphorylation	TMNEPWVYSVAGYDT ECCCCEEEEEECCCC	8.11	28295753
188	Phosphorylation	MNEPWVYSVAGYDTG CCCCEEEEEECCCCC	8.89	28295753
192	Phosphorylation	WVYSVAGYDTGRKAP EEEEEECCCCCCCCC	10.70	28295753
194	Phosphorylation	YSVAGYDTGRKAPGR EEEECCCCCCCCCCC	30.33	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BGL26_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BGL26_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BGL26_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CNIH1_ARATH	AT3G12180	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.