UniProt ID | BGL26_ARATH | |
---|---|---|
UniProt AC | O64883 | |
Protein Name | Beta-glucosidase 26, peroxisomal | |
Gene Name | BGLU26 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 560 | |
Subcellular Localization | Peroxisome . | |
Protein Description | Possesses beta-glucosidase activity toward 4-methyl-umbelliferyl-beta-D-glucoside in vitro. Possesses myrosinase activity toward indol-3-yl-methylglucosinolate (I3M) and 4-methoxy-indol-3-yl-methylglucosinolate (4MO-I3M) in vivo. [PubMed: 19095900 Component of an inducible preinvasion resistance mechanism that prevents penetration of the nonhost fungal species B.graminis and E.pisi] | |
Protein Sequence | MAHLQRTFPTEMSKGRASFPKGFLFGTASSSYQYEGAVNEGARGQSVWDHFSNRFPHRISDSSDGNVAVDFYHRYKEDIKRMKDINMDSFRLSIAWPRVLPYGKRDRGVSEEGIKFYNDVIDELLANEITPLVTIFHWDIPQDLEDEYGGFLSEQIIDDFRDYASLCFERFGDRVSLWCTMNEPWVYSVAGYDTGRKAPGRCSKYVNGASVAGMSGYEAYIVSHNMLLAHAEAVEVFRKCDHIKNGQIGIAHNPLWYEPYDPSDPDDVEGCNRAMDFMLGWHQHPTACGDYPETMKKSVGDRLPSFTPEQSKKLIGSCDYVGINYYSSLFVKSIKHVDPTQPTWRTDQGVDWMKTNIDGKQIAKQGGSEWSFTYPTGLRNILKYVKKTYGNPPILITENGYGEVAEQSQSLYMYNPSIDTERLEYIEGHIHAIHQAIHEDGVRVEGYYVWSLLDNFEWNSGYGVRYGLYYIDYKDGLRRYPKMSALWLKEFLRFDQEDDSSTSKKEEKKESYGKQLLHSVQDSQFVHSIKDSGALPAVLGSLFVVSATVGTSLFFKGANN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
176 | Phosphorylation | ERFGDRVSLWCTMNE HHHCCEEEEEEECCC | 19.62 | 28295753 | |
180 | Phosphorylation | DRVSLWCTMNEPWVY CEEEEEEECCCCEEE | 16.08 | 28295753 | |
187 | Phosphorylation | TMNEPWVYSVAGYDT ECCCCEEEEEECCCC | 8.11 | 28295753 | |
188 | Phosphorylation | MNEPWVYSVAGYDTG CCCCEEEEEECCCCC | 8.89 | 28295753 | |
192 | Phosphorylation | WVYSVAGYDTGRKAP EEEEEECCCCCCCCC | 10.70 | 28295753 | |
194 | Phosphorylation | YSVAGYDTGRKAPGR EEEECCCCCCCCCCC | 30.33 | 28295753 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BGL26_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BGL26_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BGL26_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CNIH1_ARATH | AT3G12180 | physical | 24833385 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...