| UniProt ID | BET1_MOUSE | |
|---|---|---|
| UniProt AC | O35623 | |
| Protein Name | BET1 homolog | |
| Gene Name | Bet1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 118 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type IV membrane protein. Golgi apparatus, cis-Golgi network membrane. Golgi apparatus membrane. Concentrated most in the intermediate compartment/cis-Golgi network and the cis-Golgi cisternae 1 and 2. Grea |
|
| Protein Description | Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE involved in the docking process of ER-derived vesicles with the cis-Golgi membrane (By similarity).. | |
| Protein Sequence | MRRAGLGDGAPPGSYGNYGYANTGYNACEEENDRLTESLRSKVTAIKSLSIEIGHEVKNQNKLLAEMDSQFDSTTGFLGKTMGRLKILSRGSQTKLLCYMMLFSLFVFFVIYWIIKLR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 18 | Phosphorylation | PPGSYGNYGYANTGY CCCCCCCCCCCCCCC | 13.72 | 29514104 | |
| 42 | Malonylation | LTESLRSKVTAIKSL HHHHHHHHHHHHHHH | 36.85 | 26320211 | |
| 48 | Phosphorylation | SKVTAIKSLSIEIGH HHHHHHHHHHHHHCC | 22.64 | 25521595 | |
| 50 | Phosphorylation | VTAIKSLSIEIGHEV HHHHHHHHHHHCCHH | 25.85 | 26824392 | |
| 58 | Ubiquitination | IEIGHEVKNQNKLLA HHHCCHHHCHHHHHH | 50.24 | 22790023 | |
| 62 | Ubiquitination | HEVKNQNKLLAEMDS CHHHCHHHHHHHHHH | 34.80 | 22790023 | |
| 69 | Phosphorylation | KLLAEMDSQFDSTTG HHHHHHHHHCCCCCC | 31.28 | - | |
| 80 | Ubiquitination | STTGFLGKTMGRLKI CCCCHHHHHHHHHHH | 37.17 | 22790023 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BET1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BET1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BET1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of BET1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
