BEH3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BEH3_ARATH
• UniProt AC: O49404
• Protein Name: BES1/BZR1 homolog protein 3
• Gene Name: BEH3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 284
• Protein Sequence: MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAGWTVEDDGTTYRKGCKPMDRMDLMNGSTSASPCSSYQHSPRASYNPSPSSSSFPSPTNPFGDANSLIPWLKNLSSNSPSKLPFFHGNSISAPVTPPLARSPTRDQVTIPDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDCNSPMWTPGQSGNCSPAIPAGVDQNSDVPMADGMTAEFAFGCNAMAANGMVKPWEGERIHGECVSDDLELTLGNSRTR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
147	Phosphorylation	LPFFHGNSISAPVTP CCCCCCCCCCCCCCC	23.63	23111157
149	Phosphorylation	FFHGNSISAPVTPPL CCCCCCCCCCCCCCC	26.75	29654922
153	Phosphorylation	NSISAPVTPPLARSP CCCCCCCCCCCCCCC	20.38	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BEH3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BEH3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BEH3_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of BEH3_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.