dbPTM

BEAN1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BEAN1_MOUSE
UniProt AC	Q9EQG5
Protein Name	Protein BEAN1
Gene Name	Bean1
Organism	Mus musculus (Mouse).
Sequence Length	255
Subcellular Localization	Membrane Single-pass membrane protein .
Protein Description
Protein Sequence	MSFKRPCPLARYNRTSYFYPTTFSESSEHSHLLVSPVLVASAVIGVVITLSCITIIVGSIRRDRQARIQRHHHRHRRHHHHHRHRRRRHREYASGGHTHSRSSPRMPYACSPAEDWPPPLDVSSEGDVDVTVLWELYPDSPPGYEECMGPGATQLYVPTDAPPPYSMTDSCPRLNGALDSDSGQSRSHRQQEQRTQGQSRLHTVSMDTLPPYEAVCGTGSPSDLLPLPGPEPWPSNSQGSPIPTQAPMPSPERIV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of BEAN1_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BEAN1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BEAN1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BEAN1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
NEDD4_MOUSE	Nedd4	physical	11042109

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BEAN1_MOUSE

Related Literatures of Post-Translational Modification