| UniProt ID | BEAN1_HUMAN | |
|---|---|---|
| UniProt AC | Q3B7T3 | |
| Protein Name | Protein BEAN1 | |
| Gene Name | BEAN1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 259 | |
| Subcellular Localization |
Membrane Single-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MSFKRPCPLARYNRTSYFYPTFSESSEHSHLLVSPVLVASAVIGVVIILSCITIIVGSIRRDRQARLQRHRHRHHRHHHHHHHHRRRRHREYEHGYVSDEHTYSRSSRRMRYACSSSEDWPPPLDISSDGDVDATVLRELYPDSPPGYEECVGPGATQLYVPTDAPPPYSLTDSCPTLDGTSDSGSGHSPGRHQQEQRTPAQGGLHTVSMDTLPPYEAVCGAGPPSGLLPLPGPDPGPRGSQGSPTPTRAPASGPERIV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 32 (in isoform 3) | Phosphorylation | - | 2.76 | 24719451 | |
| 35 (in isoform 3) | Phosphorylation | - | 18.91 | 24719451 | |
| 42 (in isoform 3) | Phosphorylation | - | 3.47 | 24719451 | |
| 52 (in isoform 3) | Phosphorylation | - | 2.52 | - | |
| 54 (in isoform 3) | Phosphorylation | - | 0.91 | 30631047 | |
| 61 (in isoform 3) | Phosphorylation | - | 41.62 | 30631047 | |
| 64 (in isoform 3) | Phosphorylation | - | 34.81 | - | |
| 92 | Phosphorylation | RRRRHREYEHGYVSD HHHHHHHHHCCCCCC | 17.12 | - | |
| 96 | Phosphorylation | HREYEHGYVSDEHTY HHHHHCCCCCCCCCC | 9.93 | - | |
| 98 | Phosphorylation | EYEHGYVSDEHTYSR HHHCCCCCCCCCCCC | 28.88 | 28509920 | |
| 103 | Phosphorylation | YVSDEHTYSRSSRRM CCCCCCCCCCCHHHH | 12.18 | 28509920 | |
| 128 | Ubiquitination | PPPLDISSDGDVDAT CCCCCCCCCCCCCHH | 46.04 | 29967540 | |
| 134 (in isoform 3) | Phosphorylation | - | 10.23 | 24719451 | |
| 138 (in isoform 3) | Phosphorylation | - | 27.77 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BEAN1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BEAN1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BEAN1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of BEAN1_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
