BD1L2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BD1L2_HUMAN
• UniProt AC: Q8IYS8
• Protein Name: Biorientation of chromosomes in cell division protein 1-like 2 {ECO:0000305}
• Gene Name: BOD1L2 {ECO:0000312|HGNC:HGNC:28505}
• Organism: Homo sapiens (Human).
• Sequence Length: 172
• Subcellular Localization: Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Chromosome, centromere, kinetochore .
• Protein Description: May play a role in proper chromosome biorientation through the detection or correction of syntelic attachments in mitotic spindles..
• Protein Sequence: MADGGGGGSGGAGPASTRASGGGGPINPASLPPGDPQLIAIIVGQLKSRGLFDSFRRDCKADVDTKPAYQNLSQKADNFVSTHLDKQEWNPPANDNQLHDGLRQSVVQSGRSEAGVDRISSQVVDPKLNHIFRPQIEQIIHEFLVAQKEAAVPALPPEPEGQDPPAPSQDTS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	Phosphorylation	GPASTRASGGGGPIN CCCCCCCCCCCCCCC	34.38	25693802
30	Phosphorylation	GGPINPASLPPGDPQ CCCCCHHHCCCCCHH	42.54	25693802
49	Methylation	IVGQLKSRGLFDSFR EHHHHHHCCCHHHHH	44.22	-
54	Phosphorylation	KSRGLFDSFRRDCKA HHCCCHHHHHHHHHC	17.20	28348404
66	Ubiquitination	CKADVDTKPAYQNLS HHCCCCCCHHHHHHH	24.16	22817900
69	Phosphorylation	DVDTKPAYQNLSQKA CCCCCHHHHHHHHHH	13.37	30622161
105	Phosphorylation	LHDGLRQSVVQSGRS CCHHHHHHHHHHCCC	20.16	25693802
109	Phosphorylation	LRQSVVQSGRSEAGV HHHHHHHHCCCHHCC	25.27	30622161
112	Phosphorylation	SVVQSGRSEAGVDRI HHHHHCCCHHCCCCH	35.01	30622161
120	Phosphorylation	EAGVDRISSQVVDPK HHCCCCHHHHCCCCC	18.66	30622161
121	Phosphorylation	AGVDRISSQVVDPKL HCCCCHHHHCCCCCC	25.32	30622161
127	Ubiquitination	SSQVVDPKLNHIFRP HHHCCCCCCCCCHHH	58.41	22817900
168	Phosphorylation	GQDPPAPSQDTS--- CCCCCCCCCCCC---	42.68	25627689

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BD1L2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BD1L2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BD1L2_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of BD1L2_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.