UniProt ID | BD1L2_HUMAN | |
---|---|---|
UniProt AC | Q8IYS8 | |
Protein Name | Biorientation of chromosomes in cell division protein 1-like 2 {ECO:0000305} | |
Gene Name | BOD1L2 {ECO:0000312|HGNC:HGNC:28505} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 172 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Chromosome, centromere, kinetochore . | |
Protein Description | May play a role in proper chromosome biorientation through the detection or correction of syntelic attachments in mitotic spindles.. | |
Protein Sequence | MADGGGGGSGGAGPASTRASGGGGPINPASLPPGDPQLIAIIVGQLKSRGLFDSFRRDCKADVDTKPAYQNLSQKADNFVSTHLDKQEWNPPANDNQLHDGLRQSVVQSGRSEAGVDRISSQVVDPKLNHIFRPQIEQIIHEFLVAQKEAAVPALPPEPEGQDPPAPSQDTS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Phosphorylation | GPASTRASGGGGPIN CCCCCCCCCCCCCCC | 34.38 | 25693802 | |
30 | Phosphorylation | GGPINPASLPPGDPQ CCCCCHHHCCCCCHH | 42.54 | 25693802 | |
49 | Methylation | IVGQLKSRGLFDSFR EHHHHHHCCCHHHHH | 44.22 | - | |
54 | Phosphorylation | KSRGLFDSFRRDCKA HHCCCHHHHHHHHHC | 17.20 | 28348404 | |
66 | Ubiquitination | CKADVDTKPAYQNLS HHCCCCCCHHHHHHH | 24.16 | 22817900 | |
69 | Phosphorylation | DVDTKPAYQNLSQKA CCCCCHHHHHHHHHH | 13.37 | 30622161 | |
105 | Phosphorylation | LHDGLRQSVVQSGRS CCHHHHHHHHHHCCC | 20.16 | 25693802 | |
109 | Phosphorylation | LRQSVVQSGRSEAGV HHHHHHHHCCCHHCC | 25.27 | 30622161 | |
112 | Phosphorylation | SVVQSGRSEAGVDRI HHHHHCCCHHCCCCH | 35.01 | 30622161 | |
120 | Phosphorylation | EAGVDRISSQVVDPK HHCCCCHHHHCCCCC | 18.66 | 30622161 | |
121 | Phosphorylation | AGVDRISSQVVDPKL HCCCCHHHHCCCCCC | 25.32 | 30622161 | |
127 | Ubiquitination | SSQVVDPKLNHIFRP HHHCCCCCCCCCHHH | 58.41 | 22817900 | |
168 | Phosphorylation | GQDPPAPSQDTS--- CCCCCCCCCCCC--- | 42.68 | 25627689 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BD1L2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BD1L2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BD1L2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BD1L2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...