| UniProt ID | BCAT4_ARATH | |
|---|---|---|
| UniProt AC | Q9LE06 | |
| Protein Name | Methionine aminotransferase BCAT4 | |
| Gene Name | BCAT4 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 354 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Converts 2-oxo acids to branched-chain amino acids. Shows activity with L-Leu, L-Ile and L-Val as amino donors and alpha-keto-glutarate as an amino acceptor, but no activity for D-isomers of Leu, Ile, Val, Asp, Glu or Ala. Acts on methionine and its derivatives and the corresponding 2-oxo acids. Catalyzes the initial deamination of methionine to 4-methylthio-2-oxobutyrate as well as the transamination of other typical intermediates of the methionine chain elongation pathway.. | |
| Protein Sequence | MAPSAQPLPVSVSDEKYANVKWEELAFKFVRTDYMYVAKCNHGESFQEGKILPFADLQLNPCAAVLQYGQGLYEGLKAYRTEDGRILLFRPDQNGLRLQAGADRLYMPYPSVDQFVSAIKQVALANKKWIPPPGKGTLYIRPILFGSGPILGSFPIPETTFTAFACPVGRYHKDNSGLNLKIEDQFRRAFPSGTGGVKSITNYCPVWIPLAEAKKQGFSDILFLDAATGKNIEELFAANVFMLKGNVVSTPTIAGTILPGVTRNCVMELCRDFGYQVEERTIPLVDFLDADEAFCTGTASIVTSIASVTFKDKKTGFKTGEETLAAKLYETLSDIQTGRVEDTKGWTVEIDRQG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 176 | Phosphorylation | GRYHKDNSGLNLKIE CCCCCCCCCCCCEEH | 55.58 | 19880383 | |
| 198 | N6-(pyridoxal phosphate)lysine | PSGTGGVKSITNYCP CCCCCCHHHHHHCCC | 39.14 | - | |
| 198 | Other | PSGTGGVKSITNYCP CCCCCCHHHHHHCCC | 39.14 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BCAT4_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BCAT4_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BCAT4_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of BCAT4_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
