BATF3_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BATF3_RAT
• UniProt AC: P97876
• Protein Name: Basic leucine zipper transcriptional factor ATF-like 3
• Gene Name: Batf3
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 133
• Subcellular Localization: Nucleus .
• Protein Description: AP-1 family transcription factor that controls the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha(+) classical dendritic cells (cDCs) and related CD103(+) dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens (By similarity)..
• Protein Sequence: MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSQGPPAGG ------CCCCCCCCC	43.79	-
24	Phosphorylation	APGNQPQSPKDDDRK CCCCCCCCCCCCHHH	40.37	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BATF3_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BATF3_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BATF3_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of BATF3_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.