dbPTM

BASI_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BASI_MOUSE
UniProt AC	P18572
Protein Name	Basigin
Gene Name	Bsg
Organism	Mus musculus (Mouse).
Sequence Length	389
Subcellular Localization	Cell membrane Single-pass type I membrane protein. Melanosome . Identified by mass spectrometry in melanosome fractions from stage I to stage IV (By similarity). In spermatozoa, localized on the principal piece of caput and in the middle piece duri
Protein Description	Plays an important role in targeting the monocarboxylate transporters SLC16A1, SLC16A3, SLC16A8 and SLC16A11 to the plasma membrane. Plays pivotal roles in spermatogenesis, embryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). Seems to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes..
Protein Sequence	MAAALLLALAFTLLSGQGACAAAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLDEDDPGAAPLKGSGTHMNDKDKNVRQRNAT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
160	N-linked_Glycosylation	TQLTCSLNSSGVDIV CEEEEEECCCCCEEC	20.17	19656770
190	Phosphorylation	LPDLHTKYIVDADDR CCCCCCEEEEECCCC	13.82	23984901
198	Phosphorylation	IVDADDRSGEYSCIF EEECCCCCCCEEEEE	42.86	26239621
201	Phosphorylation	ADDRSGEYSCIFLPE CCCCCCCEEEEEECC	16.62	23984901
202	Phosphorylation	DDRSGEYSCIFLPEP CCCCCCEEEEEECCC	9.09	23984901
203	S-palmitoylation	DRSGEYSCIFLPEPV CCCCCEEEEEECCCC	2.20	28526873
203	S-nitrosylation	DRSGEYSCIFLPEPV CCCCCEEEEEECCCC	2.20	22588120
203	Glutathionylation	DRSGEYSCIFLPEPV CCCCCEEEEEECCCC	2.20	24333276
238	Ubiquitination	HSSEGELAKLVCKSD CCCHHHHHHHHHCCC	9.99	27667366
269	Phosphorylation	TGEEEAITNSTEANG CCCEEEEECCCEECC	30.11	23140645
270	N-linked_Glycosylation	GEEEAITNSTEANGK CCEEEEECCCEECCE	40.60	19656770
271	Phosphorylation	EEEAITNSTEANGKY CEEEEECCCEECCEE	20.97	23140645
272	Phosphorylation	EEAITNSTEANGKYV EEEEECCCEECCEEE	40.98	23140645
275	N-linked_Glycosylation	ITNSTEANGKYVVVS EECCCEECCEEEEEE	41.06	19656770
278	Phosphorylation	STEANGKYVVVSTPE CCEECCEEEEEECCC	10.40	23140645
282	Phosphorylation	NGKYVVVSTPEKSQL CCEEEEEECCCCCCE	27.00	23140645
283	Phosphorylation	GKYVVVSTPEKSQLT CEEEEEECCCCCCEE	24.69	23140645
306	N-linked_Glycosylation	DPGTYVCNATNAQGT CCCEEEEECCCCCCC	39.49	19349973
309	N-linked_Glycosylation	TYVCNATNAQGTTRE EEEEECCCCCCCCCC	28.05	19349973
354	Ubiquitination	FIYEKRRKPDQTLDE HHHHHHCCCCCCCCC	57.91	27667366
358	Phosphorylation	KRRKPDQTLDEDDPG HHCCCCCCCCCCCCC	43.48	25521595
372	Phosphorylation	GAAPLKGSGTHMNDK CCCCCCCCCCCCCHH	38.64	27742792
374	Phosphorylation	APLKGSGTHMNDKDK CCCCCCCCCCCHHCC	21.46	25159016

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BASI_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BASI_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BASI_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of BASI_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BASI_MOUSE

Related Literatures of Post-Translational Modification

N-linked Glycosylation
Reference	PubMed
"Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."; Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M.,Schiess R., Aebersold R., Watts J.D.; Nat. Biotechnol. 27:378-386(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-160; ASN-270; ASN-275;ASN-306 AND ASN-309, AND MASS SPECTROMETRY.	19349973 [Abstract]
"The mouse C2C12 myoblast cell surface N-linked glycoproteome:identification, glycosite occupancy, and membrane orientation."; Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I.,Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E.,Wollscheid B.; Mol. Cell. Proteomics 8:2555-2569(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-160; ASN-270 AND ASN-275,AND MASS SPECTROMETRY.	19656770 [Abstract]
Phosphorylation
Reference	PubMed
"The phagosomal proteome in interferon-gamma-activated macrophages."; Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,Thibault P.; Immunity 30:143-154(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-358, AND MASSSPECTROMETRY.	19144319 [Abstract]