| UniProt ID | BARX2_HUMAN | |
|---|---|---|
| UniProt AC | Q9UMQ3 | |
| Protein Name | Homeobox protein BarH-like 2 | |
| Gene Name | BARX2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 279 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Transcription factor. Binds optimally to the DNA consensus sequence 5'-YYTAATGRTTTTY-3'. May control the expression of neural adhesion molecules such as L1 or Ng-CAM during embryonic development of both the central and peripherical nervous system. May be involved in controlling adhesive processes in keratinizing epithelia (By similarity).. | |
| Protein Sequence | MHCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHSCTGSPSLRAYPLLSVITRQPTVISHLVPATPGIAQALSCHQVTEAVSAEAPGGEALASSESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQGQEQLEPSQGQEELCEAQEPKARDVPLEMAEPPDPPQELPIPSSEPPPLS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | CHAELRLSSPGQLKA CCEEEECCCHHHHHH | 28.22 | 28348404 | |
| 11 | Phosphorylation | HAELRLSSPGQLKAA CEEEECCCHHHHHHH | 37.33 | 24719451 | |
| 23 | Ubiquitination | KAARRRYKTFMIDEI HHHHHHHHHHHHHHH | 33.21 | 21890473 | |
| 23 | Ubiquitination | KAARRRYKTFMIDEI HHHHHHHHHHHHHHH | 33.21 | 21890473 | |
| 136 | Phosphorylation | RQKKPRRSRTIFTEL CCCCCCHHHHHHHHH | 34.75 | 17081983 | |
| 159 | Phosphorylation | FQKQKYLSTPDRLDL HHHCCCCCCCCHHHH | 34.50 | 28348404 | |
| 160 | Phosphorylation | QKQKYLSTPDRLDLA HHCCCCCCCCHHHHH | 26.98 | 28348404 | |
| 187 | Acetylation | WYQNRRMKWKKMVLK HHHHHHHHHHEEHHC | 54.79 | 7668879 | |
| 189 | Acetylation | QNRRMKWKKMVLKGG HHHHHHHHEEHHCCC | 26.02 | 7668887 | |
| 194 | Trimethylation | KWKKMVLKGGQEAPT HHHEEHHCCCCCCCC | 49.97 | - | |
| 194 | Acetylation | KWKKMVLKGGQEAPT HHHEEHHCCCCCCCC | 49.97 | 7668895 | |
| 194 | Methylation | KWKKMVLKGGQEAPT HHHEEHHCCCCCCCC | 49.97 | - | |
| 211 | Phosphorylation | KGRPKKNSIPTSEEI CCCCCCCCCCCHHHH | 38.53 | 25849741 | |
| 212 | Phosphorylation | GRPKKNSIPTSEEIE CCCCCCCCCCHHHHH | 6.36 | 17525332 | |
| 214 | Phosphorylation | PKKNSIPTSEEIEAE CCCCCCCCHHHHHHH | 47.29 | 23312004 | |
| 215 | Phosphorylation | KKNSIPTSEEIEAEE CCCCCCCHHHHHHHH | 28.07 | 23312004 | |
| 237 | Phosphorylation | GQEQLEPSQGQEELC HHHHCCCCHHHHHHH | 37.25 | 17525332 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BARX2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BARX2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BARX2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of BARX2_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "ATM and ATR substrate analysis reveals extensive protein networksresponsive to DNA damage."; Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III,Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N.,Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.; Science 316:1160-1166(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-237, AND MASSSPECTROMETRY. | |