| UniProt ID | BAP18_MOUSE | |
|---|---|---|
| UniProt AC | Q9DCT6 | |
| Protein Name | Chromatin complexes subunit BAP18 | |
| Gene Name | Bap18 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 171 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of chromatin complexes such as the MLL1/MLL and NURF complexes.. | |
| Protein Sequence | MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVSDSSPAGAKWTETEIEMLRAAVKRFGDDLNHISCVIKERTVAQIKTTVKRKVYEDSGIPLPAESPKKGPKKMTSGVLSPPNAPPPSSSSVPEAGVPPIKKQKADVTLSALNDSDANSDLVDVEGLGETPPAKKLNFDQA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 26 (in isoform 4) | Phosphorylation | - | 9.89 | 25777480 | |
| 26 (in isoform 3) | Phosphorylation | - | 9.89 | 25777480 | |
| 33 (in isoform 4) | Phosphorylation | - | 35.90 | 26239621 | |
| 33 (in isoform 3) | Phosphorylation | - | 35.90 | 26239621 | |
| 35 (in isoform 4) | Phosphorylation | - | 30.62 | 26239621 | |
| 35 | Phosphorylation | QLHPVSDSSPAGAKW EEEECCCCCCCCCCC | 30.62 | 22006019 | |
| 35 (in isoform 3) | Phosphorylation | - | 30.62 | 26239621 | |
| 36 (in isoform 4) | Phosphorylation | - | 24.61 | 26239621 | |
| 36 (in isoform 3) | Phosphorylation | - | 24.61 | 26239621 | |
| 85 | Phosphorylation | TTVKRKVYEDSGIPL EEEECEEECCCCCCC | 19.63 | 25777480 | |
| 88 | Phosphorylation | KRKVYEDSGIPLPAE ECEEECCCCCCCCCC | 27.04 | 25619855 | |
| 96 | Phosphorylation | GIPLPAESPKKGPKK CCCCCCCCCCCCCCC | 44.09 | 24925903 | |
| 105 | Phosphorylation | KKGPKKMTSGVLSPP CCCCCCCCCCCCCCC | 31.07 | 25619855 | |
| 106 | Phosphorylation | KGPKKMTSGVLSPPN CCCCCCCCCCCCCCC | 24.33 | 25619855 | |
| 110 | Phosphorylation | KMTSGVLSPPNAPPP CCCCCCCCCCCCCCC | 35.59 | 25619855 | |
| 140 | Phosphorylation | QKADVTLSALNDSDA CCCCEEEECCCCCCC | 22.73 | 25619855 | |
| 145 | Phosphorylation | TLSALNDSDANSDLV EEECCCCCCCCCCCC | 37.23 | 25619855 | |
| 160 | Phosphorylation | DVEGLGETPPAKKLN CCCCCCCCCCCHHCC | 32.54 | 25619855 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BAP18_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BAP18_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BAP18_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of BAP18_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large scale localization of protein phosphorylation by use ofelectron capture dissociation mass spectrometry."; Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.; Mol. Cell. Proteomics 8:904-912(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96, AND MASSSPECTROMETRY. | |
| "Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96, AND MASSSPECTROMETRY. | |
