B9D1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: B9D1_MOUSE
• UniProt AC: Q9R1S0
• Protein Name: B9 domain-containing protein 1
• Gene Name: B9d1
• Organism: Mus musculus (Mouse).
• Sequence Length: 204
• Subcellular Localization: Cytoplasm, cytoskeleton, cilium basal body . Localizes at the transition zone, a region between the basal body and the ciliary axoneme.
• Protein Description: Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling..
• Protein Sequence: MAAASPSVFLLMITGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQIASKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPLSPGRHKRTIPMFVPESTSTLQKFTSWFMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLLFNVVTKDMKKLGYDTGPVDTQGVLGPSLPQGNPQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
111	Phosphorylation	GAVHVPLSPGRHKRT CEEEEECCCCCCCCC	21.16	22006019
183	Phosphorylation	KDMKKLGYDTGPVDT HHHHHHCCCCCCCCC	22.29	21454597
185	Phosphorylation	MKKLGYDTGPVDTQG HHHHCCCCCCCCCCC	34.60	21454597

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of B9D1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of B9D1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of B9D1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of B9D1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.