UniProt ID | B651B_ARATH | |
---|---|---|
UniProt AC | Q8VYH6 | |
Protein Name | Cytochrome b561 and DOMON domain-containing protein At4g17280 | |
Gene Name | At4g17280 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 402 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | May act as a catecholamine-responsive trans-membrane electron transporter.. | |
Protein Sequence | MSNHMSIMKFLNQILCLSLILSISMTTLSFAQTCSKYKFSSNNVFDSCNDLPFLDSFLHYTYESSTGSLHIAYRHTKLTSGKWVAWAVNPTSTGMVGAQAIVAYPQSDGTVRVYTSPIRSYQTSLLEGDLSFNVSGLSATYQNNEIVVLASLKLAQDLGNGGTINTVWQDGSMSGNSLLPHPTSGNNVRSVSTLNLVSGVSAAAGGAGGSSKLRKRNIHGILNGVSWGIMMPLGAIIARYLRVAKSADPAWFYIHVFCQASAYIIGVAGWATGLKLGGDSPGIQYSTHRAIGIALFSLATVQVFAMFLRPKPEHKHRLYWNIYHHTIGYTIIILGVVNVFKGLGILSPKKQWKNAYIGIIVVLAIVATLLEAFTWYVVIKRRKLEAKTAQHGASNGTRSQYA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of B651B_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of B651B_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of B651B_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of B651B_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...