| UniProt ID | B3GT9_ARATH | |
|---|---|---|
| UniProt AC | Q5XEZ1 | |
| Protein Name | Hydroxyproline O-galactosyltransferase HPGT3 {ECO:0000303|PubMed:25600942} | |
| Gene Name | HPGT3 {ECO:0000303|PubMed:25600942} | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 346 | |
| Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein . |
|
| Protein Description | Possesses hydroxyproline O-galactosyltransferase activity. Transfers galactose from UDP-galactose to hydroxyproline residues in the arabinogalactan proteins (AGPs). Is specific for AGPs containing non-contiguous peptidyl hydroxyproline residues. The addition of galactose onto the peptidyl hydroxyproline residues in AGP core proteins represents the first committed step in arabinogalactan polysaccharide addition. AGP glycans play essential roles in both vegetative and reproductive plant growth.. | |
| Protein Sequence | MESLPTTVPSKSERRARSSKFSQSSSKPSVIMAFFSCVAWLYVAGRLWQDAENRVVLNNILKKSYDQKPKVLTVDDKLMVLGCKDLERRIVETEMELTLAKSQGYLKNLKSGSSSGKKLLAVIGVYSGFGSHLRRNTFRGSYMPQGDALRKLEERGIVIRFVIGRSPNRGDSLDRKIDEENQARKDFLILENHEEAQEELAKKVKFFFSAAVQNWDAEFYIKVDDNIDLDLEGLIGLLESRRGQDAAYIGCMKSGEVVAEEGGKWYEPEWWKFGDEKSYFRHAAGSLLILSKTLAQYVNINSGSLKTYAFDDTSIGSWMIGVQATYIDDNRLCCSSIRQDKVCSVA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 64 | Phosphorylation | LNNILKKSYDQKPKV HHHHHHHCCCCCCCE | 32.14 | 19880383 | |
| 65 | Phosphorylation | NNILKKSYDQKPKVL HHHHHHCCCCCCCEE | 31.13 | 19880383 | |
| 73 | Phosphorylation | DQKPKVLTVDDKLMV CCCCCEEEECCEEEE | 25.52 | 19880383 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of B3GT9_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of B3GT9_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of B3GT9_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of B3GT9_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...