UniProt ID | B3GNL_HUMAN | |
---|---|---|
UniProt AC | Q67FW5 | |
Protein Name | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1 | |
Gene Name | B3GNTL1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 361 | |
Subcellular Localization | ||
Protein Description | Putative glycosyltransferase.. | |
Protein Sequence | MSGAGVGGASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKDKSGAIIEKWRVKLEDSGVHVIIGGHDSPSPRGVGYAKNQAVAQSSGSYLCFLDSDDVMMPQRVRLQHEAAVQHPSSIIGCRVRRDPPNSTERYTRWINQLTPEQLLTQVFTSNGPTVIMPTWFCSRAWFSHVGPFNEGGQGVPEDLLFFYEHLRKGGGVIRVDQSLLLYRHHPQAATHCVLETTIWTHRVRFLEEQALPRWAAFTIWNAGKQGRRLYRSLTAGSQRKVVAFCDVDENKIRKGFYCHEDSQERPKPRIPILHFRAARPPFVICVKLDLTGGAFEDNLRSLHLQEGQDFLHFS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
68 | Ubiquitination | KSGAIIEKWRVKLED CCCCEEEEEEEEEHH | 29.86 | - | |
76 | Phosphorylation | WRVKLEDSGVHVIIG EEEEEHHCCCEEEEC | 33.08 | - | |
87 | Phosphorylation | VIIGGHDSPSPRGVG EEECCCCCCCCCCCC | 22.92 | - | |
89 | Phosphorylation | IGGHDSPSPRGVGYA ECCCCCCCCCCCCHH | 31.05 | 17081983 | |
97 | Ubiquitination | PRGVGYAKNQAVAQS CCCCCHHHCHHHHHC | 40.90 | - | |
271 | Ubiquitination | FTIWNAGKQGRRLYR HHHHHCCHHHHHHHH | 47.36 | 21890473 | |
287 | Ubiquitination | LTAGSQRKVVAFCDV CCCCCCCEEEEEEEC | 33.16 | - | |
301 | Ubiquitination | VDENKIRKGFYCHED CCCCCEECCEECCCC | 57.77 | - | |
314 | Ubiquitination | EDSQERPKPRIPILH CCCCCCCCCCCCEEE | 53.82 | - | |
338 | Phosphorylation | ICVKLDLTGGAFEDN EEEEEECCCCHHHHC | 32.98 | 27542207 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of B3GNL_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of B3GNL_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of B3GNL_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of B3GNL_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...