| UniProt ID | B3GNL_HUMAN | |
|---|---|---|
| UniProt AC | Q67FW5 | |
| Protein Name | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1 | |
| Gene Name | B3GNTL1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 361 | |
| Subcellular Localization | ||
| Protein Description | Putative glycosyltransferase.. | |
| Protein Sequence | MSGAGVGGASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKDKSGAIIEKWRVKLEDSGVHVIIGGHDSPSPRGVGYAKNQAVAQSSGSYLCFLDSDDVMMPQRVRLQHEAAVQHPSSIIGCRVRRDPPNSTERYTRWINQLTPEQLLTQVFTSNGPTVIMPTWFCSRAWFSHVGPFNEGGQGVPEDLLFFYEHLRKGGGVIRVDQSLLLYRHHPQAATHCVLETTIWTHRVRFLEEQALPRWAAFTIWNAGKQGRRLYRSLTAGSQRKVVAFCDVDENKIRKGFYCHEDSQERPKPRIPILHFRAARPPFVICVKLDLTGGAFEDNLRSLHLQEGQDFLHFS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 68 | Ubiquitination | KSGAIIEKWRVKLED CCCCEEEEEEEEEHH | 29.86 | - | |
| 76 | Phosphorylation | WRVKLEDSGVHVIIG EEEEEHHCCCEEEEC | 33.08 | - | |
| 87 | Phosphorylation | VIIGGHDSPSPRGVG EEECCCCCCCCCCCC | 22.92 | - | |
| 89 | Phosphorylation | IGGHDSPSPRGVGYA ECCCCCCCCCCCCHH | 31.05 | 17081983 | |
| 97 | Ubiquitination | PRGVGYAKNQAVAQS CCCCCHHHCHHHHHC | 40.90 | - | |
| 271 | Ubiquitination | FTIWNAGKQGRRLYR HHHHHCCHHHHHHHH | 47.36 | 21890473 | |
| 287 | Ubiquitination | LTAGSQRKVVAFCDV CCCCCCCEEEEEEEC | 33.16 | - | |
| 301 | Ubiquitination | VDENKIRKGFYCHED CCCCCEECCEECCCC | 57.77 | - | |
| 314 | Ubiquitination | EDSQERPKPRIPILH CCCCCCCCCCCCEEE | 53.82 | - | |
| 338 | Phosphorylation | ICVKLDLTGGAFEDN EEEEEECCCCHHHHC | 32.98 | 27542207 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of B3GNL_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of B3GNL_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of B3GNL_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of B3GNL_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
