B2MG_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: B2MG_MOUSE
• UniProt AC: P01887
• Protein Name: Beta-2-microglobulin
• Gene Name: B2m
• Organism: Mus musculus (Mouse).
• Sequence Length: 119
• Subcellular Localization: Secreted.
• Protein Description: Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system..
• Protein Sequence: MARSVTLVFLVLVSLTGLYAIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
30	Phosphorylation	KTPQIQVYSRHPPEN HCCCEEEEECCCCCC	5.43	-
45	Glutathionylation	GKPNILNCYVTQFHP CCCCEEEEEEEECCC	2.31	24333276
100	Glutathionylation	TETDTYACRVKHASM CCCCCEEEEEEECCC	3.46	24333276

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of B2MG_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of B2MG_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of B2MG_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of B2MG_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.