UniProt ID | B2MG_MOUSE | |
---|---|---|
UniProt AC | P01887 | |
Protein Name | Beta-2-microglobulin | |
Gene Name | B2m | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 119 | |
Subcellular Localization | Secreted. | |
Protein Description | Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system.. | |
Protein Sequence | MARSVTLVFLVLVSLTGLYAIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Phosphorylation | KTPQIQVYSRHPPEN HCCCEEEEECCCCCC | 5.43 | - | |
45 | Glutathionylation | GKPNILNCYVTQFHP CCCCEEEEEEEECCC | 2.31 | 24333276 | |
100 | Glutathionylation | TETDTYACRVKHASM CCCCCEEEEEEECCC | 3.46 | 24333276 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of B2MG_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of B2MG_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of B2MG_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of B2MG_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...