AX2R_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AX2R_HUMAN
• UniProt AC: Q3ZCQ2
• Protein Name: Annexin-2 receptor
• Gene Name: ANXA2R
• Organism: Homo sapiens (Human).
• Sequence Length: 193
• Protein Description: May act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation..
• Protein Sequence: MEQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDSCDLGLLSSPCWRLPGVYWQNGLSPGVQSTLEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDRLRLQQLPWSSPLHPWDRQQDTEVCDSGCLLERRHPPALQPWRHLPGFSDCLEWILRVGFAAFSVLWACCSRICGAKQP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
124	Phosphorylation	RLQQLPWSSPLHPWD EEECCCCCCCCCCCC	21.82	26074081
125	Phosphorylation	LQQLPWSSPLHPWDR EECCCCCCCCCCCCC	27.84	26074081
178	Phosphorylation	RVGFAAFSVLWACCS HHHHHHHHHHHHHHH	16.15	50570879
185	Phosphorylation	SVLWACCSRICGAKQ HHHHHHHHHHHCCCC	25.27	50570883

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AX2R_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AX2R_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AX2R_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of AX2R_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.