UniProt ID | AVEN_MOUSE | |
---|---|---|
UniProt AC | Q9D9K3 | |
Protein Name | Cell death regulator Aven | |
Gene Name | Aven | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 342 | |
Subcellular Localization |
Endomembrane system Peripheral membrane protein. Associated with intracellular membranes.. |
|
Protein Description | Protects against apoptosis mediated by Apaf-1.. | |
Protein Sequence | MQAERGARGGRGRRGGRERPGGDREPVGAATALARGGCGDGGGRRGRGRGFRRGRGGGGLRGGRWEPGGRGGGASTRVEEDSDSETYGEENDEQGNFSRRKIVSNWDRYQDTEKEVNGESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDGETSCPKQNSALYVDSESLVRALEQLPLAVRLNVASELIQTTIPLELPQVKPRRNDDGKELGMHLRGPISELRSAAGACPRSLGRGSLRQSPLEGLQKAPTPTQSVADHLEEELDMLLHLDAPVQEEGNISPDQTSRDQEPEKDGQVAQEETGPEKPSVTREKNVEPEQPSTSKNVTEEELEDWLDSMIS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Phosphorylation | REPVGAATALARGGC CCCCCHHHHHHCCCC | 22.97 | 21454597 | |
70 | Methylation | GRWEPGGRGGGASTR CCCCCCCCCCCCCCC | 46.64 | - | |
82 | Phosphorylation | STRVEEDSDSETYGE CCCEECCCCCCCCCC | 46.44 | 25521595 | |
84 | Phosphorylation | RVEEDSDSETYGEEN CEECCCCCCCCCCCC | 35.47 | 25521595 | |
86 | Phosphorylation | EEDSDSETYGEENDE ECCCCCCCCCCCCCC | 40.55 | 25521595 | |
87 | Phosphorylation | EDSDSETYGEENDEQ CCCCCCCCCCCCCCC | 20.63 | 25619855 | |
139 | Phosphorylation | LLSSAGDSFSQFRFA EECCCCCCCHHCCCC | 26.36 | 29899451 | |
203 | Ubiquitination | PLELPQVKPRRNDDG CCCCCCCCCCCCCCC | 27.79 | 22790023 | |
237 | Dimethylation | ACPRSLGRGSLRQSP CCCCHHCCCCCCCCC | 36.50 | - | |
243 | Phosphorylation | GRGSLRQSPLEGLQK CCCCCCCCCCCHHHC | 25.64 | 28066266 | |
253 | Phosphorylation | EGLQKAPTPTQSVAD CHHHCCCCCCHHHHH | 43.77 | 25293948 | |
255 | Phosphorylation | LQKAPTPTQSVADHL HHCCCCCCHHHHHHH | 35.63 | 25293948 | |
257 | Phosphorylation | KAPTPTQSVADHLEE CCCCCCHHHHHHHHH | 23.04 | 25293948 | |
283 | Phosphorylation | VQEEGNISPDQTSRD CCCCCCCCCCCCCCC | 26.82 | 21659605 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AVEN_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AVEN_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AVEN_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AVEN_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...