UniProt ID | ATTC_DROME | |
---|---|---|
UniProt AC | Q95NH6 | |
Protein Name | Attacin-C | |
Gene Name | AttC | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 241 | |
Subcellular Localization | Secreted . | |
Protein Description | Has antimicrobial activity in synergy with other peptides. Strongest activity observed against E.cloacae.. | |
Protein Sequence | MSKIVLLIVVIVGVLGSLAVALPQRPYTQPLIYYPPPPTPPRIYRARRQVLGGSLTSNPSGGADARLDLSKAVGTPDHHVIGQVFAAGNTQTKPVSTPVTSGATLGYNNHGHGLELTKTHTPGVRDSFQQTATANLFNNGVHNLDAKAFASQNQLANGFKFDRNGAALDYSHIKGHGATLTHANIPGLGKQLELGGRANLWQSQDRNTRLDLGSTASKWTSGPFKGQTDLGANLGLSHYFG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Pyrrolidone_carboxylic_acid | SLAVALPQRPYTQPL HHHHHCCCCCCCCCE | 60.89 | - | |
24 | Pyrrolidone_carboxylic_acid | SLAVALPQRPYTQPL HHHHHCCCCCCCCCE | 60.89 | 14744858 | |
24 | Pyrrolidone_carboxylic_acid | SLAVALPQRPYTQPL HHHHHCCCCCCCCCE | 60.89 | 14744858 | |
39 | O-linked_Glycosylation | IYYPPPPTPPRIYRA EECCCCCCCCHHHHH | 52.26 | 14744858 | |
127 | Phosphorylation | HTPGVRDSFQQTATA CCCCCHHHHHHHHHH | 17.87 | 14744858 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATTC_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATTC_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATTC_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ATTC_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...