dbPTM

ATTC_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ATTC_DROME
UniProt AC	Q95NH6
Protein Name	Attacin-C
Gene Name	AttC
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	241
Subcellular Localization	Secreted .
Protein Description	Has antimicrobial activity in synergy with other peptides. Strongest activity observed against E.cloacae..
Protein Sequence	MSKIVLLIVVIVGVLGSLAVALPQRPYTQPLIYYPPPPTPPRIYRARRQVLGGSLTSNPSGGADARLDLSKAVGTPDHHVIGQVFAAGNTQTKPVSTPVTSGATLGYNNHGHGLELTKTHTPGVRDSFQQTATANLFNNGVHNLDAKAFASQNQLANGFKFDRNGAALDYSHIKGHGATLTHANIPGLGKQLELGGRANLWQSQDRNTRLDLGSTASKWTSGPFKGQTDLGANLGLSHYFG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
24	Pyrrolidone_carboxylic_acid	SLAVALPQRPYTQPL HHHHHCCCCCCCCCE	60.89	-
24	Pyrrolidone_carboxylic_acid	SLAVALPQRPYTQPL HHHHHCCCCCCCCCE	60.89	14744858
24	Pyrrolidone_carboxylic_acid	SLAVALPQRPYTQPL HHHHHCCCCCCCCCE	60.89	14744858
39	O-linked_Glycosylation	IYYPPPPTPPRIYRA EECCCCCCCCHHHHH	52.26	14744858
127	Phosphorylation	HTPGVRDSFQQTATA CCCCCHHHHHHHHHH	17.87	14744858

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ATTC_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ATTC_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ATTC_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ATTC_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ATTC_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-127, AND MASSSPECTROMETRY.	18327897 [Abstract]