ATRAP_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATRAP_MOUSE
• UniProt AC: Q9WVK0
• Protein Name: Type-1 angiotensin II receptor-associated protein
• Gene Name: Agtrap
• Organism: Mus musculus (Mouse).
• Sequence Length: 161
• Subcellular Localization: Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Present in perinuclear vesicular membranes, Endoplasmic reticulum, Golgi an
• Protein Description: Appears to be a negative regulator of type-1 angiotensin II receptor-mediated signaling by regulating receptor internalisation as well as mechanism of receptor desensitization such as phosphorylation. Induces also a decrease in angiotensin II-stimulated transcriptional activity. May play a role of negative regulator in cardiomyocyte hypertrophy induced by angiotensin II through an inhibition of p38 mitogen-activated protein kinase pathway..
• Protein Sequence: MELPAVNLKVILLVHWLLTTWGCLVFSSSYAWGNFTILALGVWAVAQRDSIDAIGMFLGGLVATIFLDIIYISIFYSSVATGDTGRFGAGMAILSLLLKPFSCCLVYHMHRERGGELPLRPDFFGPSQEHSAYQTIDSSSDAAADPFASLENKGQAVPRGY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
127	Phosphorylation	RPDFFGPSQEHSAYQ CCCCCCCCCCCCCCC	48.88	25293948
131	Phosphorylation	FGPSQEHSAYQTIDS CCCCCCCCCCCCCCC	28.11	25293948
133	Phosphorylation	PSQEHSAYQTIDSSS CCCCCCCCCCCCCCC	14.81	25293948
135	Phosphorylation	QEHSAYQTIDSSSDA CCCCCCCCCCCCCCC	17.67	25293948
138	Phosphorylation	SAYQTIDSSSDAAAD CCCCCCCCCCCCCCC	28.08	25293948
139	Phosphorylation	AYQTIDSSSDAAADP CCCCCCCCCCCCCCC	28.61	25293948
140	Phosphorylation	YQTIDSSSDAAADPF CCCCCCCCCCCCCCC	34.91	25293948
149	Phosphorylation	AAADPFASLENKGQA CCCCCCHHHCCCCCC	36.27	30352176
153	Ubiquitination	PFASLENKGQAVPRG CCHHHCCCCCCCCCC	42.92	22790023
153	Ubiquitination	PFASLENKGQAVPRG CCHHHCCCCCCCCCC	42.92	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATRAP_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATRAP_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATRAP_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of ATRAP_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.