UniProt ID | ATPK_MOUSE | |
---|---|---|
UniProt AC | P56135 | |
Protein Name | ATP synthase subunit f, mitochondrial | |
Gene Name | Atp5j2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 88 | |
Subcellular Localization |
Mitochondrion. Mitochondrion inner membrane Single-pass membrane protein . |
|
Protein Description | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane.. | |
Protein Sequence | MASLVPLKEKKLMEVKLGELPSWIMMRDFTPSGIAGAFRRGYDRYYNKYINVRKGSISGISMVLAAYVVFSYCISYKELKHERRRKYH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MASLVPLKE ------CCCCCCCCC | 16.15 | - | |
3 | Phosphorylation | -----MASLVPLKEK -----CCCCCCCCCC | 28.71 | 23737553 | |
8 | Acetylation | MASLVPLKEKKLMEV CCCCCCCCCCCCCEE | 62.51 | 23576753 | |
8 | Malonylation | MASLVPLKEKKLMEV CCCCCCCCCCCCCEE | 62.51 | 26320211 | |
8 | Succinylation | MASLVPLKEKKLMEV CCCCCCCCCCCCCEE | 62.51 | 26388266 | |
10 | Acetylation | SLVPLKEKKLMEVKL CCCCCCCCCCCEEEC | 50.01 | 24062335 | |
11 | Acetylation | LVPLKEKKLMEVKLG CCCCCCCCCCEEECC | 54.91 | 24062335 | |
16 | Acetylation | EKKLMEVKLGELPSW CCCCCEEECCCCCCE | 37.15 | 23576753 | |
16 | Succinylation | EKKLMEVKLGELPSW CCCCCEEECCCCCCE | 37.15 | 24315375 | |
30 | Phosphorylation | WIMMRDFTPSGIAGA EEECCCCCCCCHHHH | 22.34 | 22817900 | |
32 | Phosphorylation | MMRDFTPSGIAGAFR ECCCCCCCCHHHHHH | 39.51 | 22817900 | |
48 | Acetylation | GYDRYYNKYINVRKG CHHHHHCCCEEECCC | 31.24 | 23864654 | |
48 | Ubiquitination | GYDRYYNKYINVRKG CHHHHHCCCEEECCC | 31.24 | 22790023 | |
80 | Acetylation | CISYKELKHERRRKY HCCHHHHHHHHHHCC | 44.50 | 23864654 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATPK_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATPK_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATPK_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ATPK_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...