ATPE_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATPE_ARATH
• UniProt AC: P09468
• Protein Name: ATP synthase epsilon chain, chloroplastic {ECO:0000255|HAMAP-Rule:MF_00530}
• Gene Name: atpE {ECO:0000255|HAMAP-Rule:MF_00530}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 132
• Subcellular Localization: Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein .
• Protein Description: Produces ATP from ADP in the presence of a proton gradient across the membrane..
• Protein Sequence: MTLNLCVLTPNRIVWDSEVKEIILSTNSGQIGVLANHAPIATAVDIGILKIRLANQWLTMALMGGFARIGNNEITILVNDAEKNSDIDPQEAQQTLEIAEANLRKAEGKRQTIEANLALRRARTRVEALNTI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MTLNLCVLT ------CCEEEEEEC	25.10	22223895
112	Phosphorylation	KAEGKRQTIEANLAL HHHCCHHHHHHHHHH	25.47	25368622

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATPE_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATPE_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATPE_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of ATPE_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.