| UniProt ID | ATPB1_DROME | |
|---|---|---|
| UniProt AC | Q24046 | |
| Protein Name | Sodium/potassium-transporting ATPase subunit beta-1 | |
| Gene Name | nrv1 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 309 | |
| Subcellular Localization |
Cell membrane Single-pass type II membrane protein . |
|
| Protein Description | This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane.. | |
| Protein Sequence | MSKNNGKGAKGEFEFPQPAKKQTFSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLSTISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNHTEGRDMKHCGFGQVLEPTDVCVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQGFPSYYYPFLNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDRKGSVTFQILLD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 133 | N-linked_Glycosylation | DDFLRDYNHTEGRDM HHHHHCCCCCCCCCC | 39.63 | 17893096 | |
| 211 | N-linked_Glycosylation | DDLKKVINETKTEER HHHHHHHHHCCCHHH | 54.60 | 17893096 | |
| 294 | Phosphorylation | KNIQYSGSVRDRKGS HCCEEECCCCCCCCC | 14.19 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATPB1_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATPB1_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATPB1_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| 41_DROME | cora | physical | 12782686 | |
| NRX4_DROME | Nrx-IV | physical | 12782686 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Identification of N-glycosylated proteins from the central nervoussystem of Drosophila melanogaster."; Koles K., Lim J.-M., Aoki K., Porterfield M., Tiemeyer M., Wells L.,Panin V.; Glycobiology 17:1388-1403(2007). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-133 AND ASN-211, AND MASSSPECTROMETRY. | |