UniProt ID | ATP8_MOUSE | |
---|---|---|
UniProt AC | P03930 | |
Protein Name | ATP synthase protein 8 | |
Gene Name | Mtatp8 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 67 | |
Subcellular Localization |
Mitochondrion membrane Single-pass membrane protein. |
|
Protein Description | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity).. | |
Protein Sequence | MPQLDTSTWFITIISSMITLFILFQLKVSSQTFPLAPSPKSLTTMKVKTPWELKWTKIYLPHSLPQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Phosphorylation | PLAPSPKSLTTMKVK CCCCCCCCCCCCEEC | 34.04 | 23737553 | |
43 | Phosphorylation | APSPKSLTTMKVKTP CCCCCCCCCCEECCC | 31.75 | 23737553 | |
44 | Phosphorylation | PSPKSLTTMKVKTPW CCCCCCCCCEECCCC | 21.93 | 23737553 | |
46 | Acetylation | PKSLTTMKVKTPWEL CCCCCCCEECCCCEE | 38.19 | 23806337 | |
46 | Succinylation | PKSLTTMKVKTPWEL CCCCCCCEECCCCEE | 38.19 | 23806337 | |
46 | Malonylation | PKSLTTMKVKTPWEL CCCCCCCEECCCCEE | 38.19 | 26320211 | |
48 | Acetylation | SLTTMKVKTPWELKW CCCCCEECCCCEEEE | 43.27 | 23864654 | |
48 | Succinylation | SLTTMKVKTPWELKW CCCCCEECCCCEEEE | 43.27 | 23806337 | |
48 | Malonylation | SLTTMKVKTPWELKW CCCCCEECCCCEEEE | 43.27 | 26320211 | |
54 | Acetylation | VKTPWELKWTKIYLP ECCCCEEEEEEEECC | 41.10 | 23576753 | |
54 | Succinylation | VKTPWELKWTKIYLP ECCCCEEEEEEEECC | 41.10 | - | |
54 | Succinylation | VKTPWELKWTKIYLP ECCCCEEEEEEEECC | 41.10 | 23806337 | |
57 | Acetylation | PWELKWTKIYLPHSL CCEEEEEEEECCCCC | 28.39 | 23576753 | |
57 | Ubiquitination | PWELKWTKIYLPHSL CCEEEEEEEECCCCC | 28.39 | - | |
57 | Succinylation | PWELKWTKIYLPHSL CCEEEEEEEECCCCC | 28.39 | 23954790 | |
63 | Phosphorylation | TKIYLPHSLPQQ--- EEEECCCCCCCC--- | 39.54 | 23737553 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATP8_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATP8_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATP8_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ATP8_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Substrate and functional diversity of lysine acetylation revealed bya proteomics survey."; Kim S.C., Sprung R., Chen Y., Xu Y., Ball H., Pei J., Cheng T.,Kho Y., Xiao H., Xiao L., Grishin N.V., White M., Yang X.-J., Zhao Y.; Mol. Cell 23:607-618(2006). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-54, AND MASS SPECTROMETRY. |