ATP6_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATP6_HUMAN
• UniProt AC: P00846
• Protein Name: ATP synthase subunit a
• Gene Name: MT-ATP6
• Organism: Homo sapiens (Human).
• Sequence Length: 226
• Subcellular Localization: Mitochondrion inner membrane; Multi-pass membrane protein.
• Protein Description: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane..
• Protein Sequence: MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSKIKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLAMSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
55	2-Hydroxyisobutyrylation	WLIKLTSKQMMTMHN HHHHHHHCHHHHHCC	36.66	-
59	Phosphorylation	LTSKQMMTMHNTKGR HHHCHHHHHCCCCCH	15.22	25599653
63	Phosphorylation	QMMTMHNTKGRTWSL HHHHHCCCCCHHHHH	21.87	25599653

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATP6_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATP6_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATP6_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of ATP6_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.