UniProt ID | ATP5H_ARATH | |
---|---|---|
UniProt AC | Q9FT52 | |
Protein Name | ATP synthase subunit d, mitochondrial | |
Gene Name | At3g52300 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 168 | |
Subcellular Localization | Mitochondrion. Mitochondrion inner membrane. | |
Protein Description | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements (By similarity).. | |
Protein Sequence | MSGAGKKIADVAFKASRTIDWDGMAKVLVTDEARREFSNLRRAFDEVNTQLQTKFSQEPEPIDWDYYRKGIGAGIVDKYKEAYDSIEIPKYVDKVTPEYKPKFDALLVELKEAEQKSLKESERLEKEIADVQEISKKLSTMTADEYFEKHPELKKKFDDEIRNDNWGY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
90 | Acetylation | YDSIEIPKYVDKVTP HHHCCCCHHHCCCCC | 64.66 | 24727099 | |
94 | Acetylation | EIPKYVDKVTPEYKP CCCHHHCCCCCCCCC | 37.65 | 24727099 | |
96 | Phosphorylation | PKYVDKVTPEYKPKF CHHHCCCCCCCCCCC | 19.02 | 22092075 | |
102 | Acetylation | VTPEYKPKFDALLVE CCCCCCCCCCHHHHH | 52.29 | 24727099 | |
111 | Acetylation | DALLVELKEAEQKSL CHHHHHHHHHHHHCH | 41.18 | 24727099 | |
116 | Acetylation | ELKEAEQKSLKESER HHHHHHHHCHHHHHH | 49.62 | 24727099 | |
149 | Acetylation | TADEYFEKHPELKKK CHHHHHHHCHHHHHH | 55.34 | 24727099 | |
156 | Acetylation | KHPELKKKFDDEIRN HCHHHHHHHCHHHHC | 53.06 | 24727099 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATP5H_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATP5H_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATP5H_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ATP5H_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...