UniProt ID | ATP23_HUMAN | |
---|---|---|
UniProt AC | Q9Y6H3 | |
Protein Name | Mitochondrial inner membrane protease ATP23 homolog | |
Gene Name | ATP23 {ECO:0000312|HGNC:HGNC:29452} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 246 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQKCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHFSCEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
58 | Ubiquitination | KCQLRLLKTLETNPY HHEEHHHHHHCCCHH | 56.51 | 29967540 | |
76 | Phosphorylation | LLDAMKHSGCAVNKD HHHHHHHCCCCCCCC | 30.01 | 24425749 | |
203 | Ubiquitination | ISKEVAKKAVDEVFE CCHHHHHHHHHHHHH | 43.86 | 29967540 | |
226 | Ubiquitination | FGRIPHNKTYARYAH CCCCCCCCCCHHHCC | 39.62 | 29967540 | |
227 | Phosphorylation | GRIPHNKTYARYAHR CCCCCCCCCHHHCCC | 27.94 | - | |
228 | Phosphorylation | RIPHNKTYARYAHRD CCCCCCCCHHHCCCC | 7.24 | - | |
231 | Phosphorylation | HNKTYARYAHRDFEN CCCCCHHHCCCCCCC | 9.89 | - | |
243 | Phosphorylation | FENRDRYYSNI---- CCCCHHHCCCC---- | 8.99 | 22461510 | |
244 | Phosphorylation | ENRDRYYSNI----- CCCHHHCCCC----- | 21.08 | 22461510 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATP23_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATP23_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATP23_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ATP23_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...