ATG8E_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATG8E_ARATH
• UniProt AC: Q8S926
• Protein Name: Autophagy-related protein 8e
• Gene Name: ATG8E
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 122
• Subcellular Localization: Cytoplasmic vesicle, autophagosome membrane ; Lipid-anchor . Vacuole membrane ; Lipid-anchor . Cytoplasm, cytoskeleton .
• Protein Description: Ubiquitin-like modifier involved in autophagosomes formation. May mediate the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton..
• Protein Sequence: MNKGSIFKMDNDFEKRKAEAGRIREKYPDRIPVIVEKAEKSEVPNIDKKKYLVPSDLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGELMSSVYEDKKDEDGFLYITYSGENTFGASSI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
118	Phosphatidylethanolamine amidation	YSGENTFGASSI--- ECCCCCCCCCCC---	23.63	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATG8E_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
118	G	Amidation	This Gly-118 forms then a thioester bond with the 'Cys-558' of ATG7 (E1-like activating enzyme) before being transferred to the 'Cys-258' of ATG3 (the specific E2 conjugating enzyme), in order to be finally amidated with phosphatidylethanolamine.	-
258	C	Amidation	This Gly-118 forms then a thioester bond with the 'Cys-558' of ATG7 (E1-like activating enzyme) before being transferred to the 'Cys-258' of ATG3 (the specific E2 conjugating enzyme), in order to be finally amidated with phosphatidylethanolamine.	-
558	C	Amidation	This Gly-118 forms then a thioester bond with the 'Cys-558' of ATG7 (E1-like activating enzyme) before being transferred to the 'Cys-258' of ATG3 (the specific E2 conjugating enzyme), in order to be finally amidated with phosphatidylethanolamine.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATG8E_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.