dbPTM

ATG14_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ATG14_SCHPO
UniProt AC	O42862
Protein Name	Autophagy-related protein 14
Gene Name	atg14
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	390
Subcellular Localization	Cytoplasm. Preautophagosomal structure membrane Peripheral membrane protein. Vacuole membrane Peripheral membrane protein.
Protein Description	Required for cytoplasm to vacuole transport (Cvt) and autophagy as a part of the autophagy-specific vps34 PI3-kinase complex I. This complex is essential to recruit the atg8-phosphatidylinositol conjugate and the atg12-atg5 conjugate to the preautophagosomal structure. Atg14 mediates the specific binding of the vps34 PI3-kinase complex I to the preautophagosomal structure (PAS) (By similarity)..
Protein Sequence	MLHVNKCQLCETRRPSICESCLKKQLYDFYHKRDEFSRDIESELEKVAKLKSESFSLKGKITQKEELTYRLQNLAASLNEKKSLSCDLHSRKQLIEDDLSNRKKSINIASQKLAGLSHSTSDYFSKEYLTAYRRSELLQNKLHEYQKKLITRVLDMYQLHWQRDLVLNTQGCTQKSAQMGSEFNPDSIDSSLAYRLSKLSMGNSKSDLSHSDNETGHFYSNFFSQVMELNASVTISGIPVCIRSKEKMFLNPDCALTLSFICIFLAQYTSIPLPCPLQLPSPDQKPMTSFSSEQMLYIMYNIVWISWNCGIFSFPRGITQSQLFELMQYTGFWLVQLRTKPLTSQKPDWHYKMGMDFDLFHRLYLARLPIPINYSSLRSRSSSKPYQLIS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
135	Phosphorylation	YLTAYRRSELLQNKL HHHHHHHHHHHHHHH	40.63	29996109
145	Phosphorylation	LQNKLHEYQKKLITR HHHHHHHHHHHHHHH	13.90	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ATG14_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ATG14_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ATG14_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ATG14_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ATG14_SCHPO

Related Literatures of Post-Translational Modification