UniProt ID | ATG14_SCHPO | |
---|---|---|
UniProt AC | O42862 | |
Protein Name | Autophagy-related protein 14 | |
Gene Name | atg14 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 390 | |
Subcellular Localization |
Cytoplasm. Preautophagosomal structure membrane Peripheral membrane protein. Vacuole membrane Peripheral membrane protein. |
|
Protein Description | Required for cytoplasm to vacuole transport (Cvt) and autophagy as a part of the autophagy-specific vps34 PI3-kinase complex I. This complex is essential to recruit the atg8-phosphatidylinositol conjugate and the atg12-atg5 conjugate to the preautophagosomal structure. Atg14 mediates the specific binding of the vps34 PI3-kinase complex I to the preautophagosomal structure (PAS) (By similarity).. | |
Protein Sequence | MLHVNKCQLCETRRPSICESCLKKQLYDFYHKRDEFSRDIESELEKVAKLKSESFSLKGKITQKEELTYRLQNLAASLNEKKSLSCDLHSRKQLIEDDLSNRKKSINIASQKLAGLSHSTSDYFSKEYLTAYRRSELLQNKLHEYQKKLITRVLDMYQLHWQRDLVLNTQGCTQKSAQMGSEFNPDSIDSSLAYRLSKLSMGNSKSDLSHSDNETGHFYSNFFSQVMELNASVTISGIPVCIRSKEKMFLNPDCALTLSFICIFLAQYTSIPLPCPLQLPSPDQKPMTSFSSEQMLYIMYNIVWISWNCGIFSFPRGITQSQLFELMQYTGFWLVQLRTKPLTSQKPDWHYKMGMDFDLFHRLYLARLPIPINYSSLRSRSSSKPYQLIS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATG14_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATG14_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATG14_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ATG14_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...