| UniProt ID | ATF4_RAT | |
|---|---|---|
| UniProt AC | Q9ES19 | |
| Protein Name | Cyclic AMP-dependent transcription factor ATF-4 | |
| Gene Name | Atf4 {ECO:0000312|RGD:621863} | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 347 | |
| Subcellular Localization | Cytoplasm . Cell membrane . Nucleus . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Colocalizes with GABBR1 in hippocampal neuron dendritic membranes (PubMed:10924501). Colocalizes with NEK6 in the centrosome (By similarity). | |
| Protein Description | Transcriptional activator. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Cooperates with FOXO1 in osteoblasts to regulate glucose homeostasis through suppression of beta-cell production and decrease in insulin production (By similarity). Regulates the induction of DDIT3/CHOP and asparagine synthetase (ASNS) in response to ER stress. In concert with DDIT3/CHOP, activates the transcription of TRIB3 and promotes ER stress-induced neuronal apoptosis by regulating the transcriptional induction of BBC3/PUMA. Activates transcription of SIRT4. Regulates the circadian expression of the core clock component PER2 and the serotonin transporter SLC6A4. Binds in a circadian time-dependent manner to the cAMP response elements (CRE) in the SLC6A4 and PER2 promoters and periodically activates the transcription of these genes (By similarity).. | |
| Protein Sequence | MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAGSSEWLAMDGLVSASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLATLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESVIKVDQAAPFTFLQPLPCSPGFLSSTPDHSFSLELGSEVDISEGDRKPDSAAYITLTPQCVKEEDTPSDSDSGICMSPESYLGSPQHSPSTSRAPPDSLPSPGVPRGSRPKPYDPPGVSVTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 211 | Phosphorylation | QCVKEEDTPSDSDSG HHHCCCCCCCCCCCC | 28.15 | - | |
| 213 | Phosphorylation | VKEEDTPSDSDSGIC HCCCCCCCCCCCCCC | 52.41 | - | |
| 217 | Phosphorylation | DTPSDSDSGICMSPE CCCCCCCCCCCCCHH | 33.73 | - | |
| 222 | Phosphorylation | SDSGICMSPESYLGS CCCCCCCCHHHHCCC | 22.54 | - | |
| 229 | Phosphorylation | SPESYLGSPQHSPST CHHHHCCCCCCCCCC | 20.84 | - | |
| 233 | Phosphorylation | YLGSPQHSPSTSRAP HCCCCCCCCCCCCCC | 18.46 | - | |
| 234 | Hydroxylation | LGSPQHSPSTSRAPP CCCCCCCCCCCCCCC | 39.23 | - | |
| 243 | Phosphorylation | TSRAPPDSLPSPGVP CCCCCCCCCCCCCCC | 48.21 | 26437020 | |
| 246 | Phosphorylation | APPDSLPSPGVPRGS CCCCCCCCCCCCCCC | 39.31 | 26437020 | |
| 307 | Acetylation | EALTGECKELEKKNE HHHHHHHHHHHHHHH | 62.12 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATF4_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 211 | T | Phosphorylation |
| - |
| 211 | T | ubiquitylation |
| - |
| 213 | S | Phosphorylation |
| - |
| 217 | S | Phosphorylation |
| - |
| 217 | S | ubiquitylation |
| - |
| 222 | S | Phosphorylation |
| - |
| 222 | S | ubiquitylation |
| - |
| 229 | S | Phosphorylation |
| - |
| 229 | S | ubiquitylation |
| - |
| 233 | S | Phosphorylation |
| - |
| 233 | S | ubiquitylation |
| - |
| 243 | S | Phosphorylation |
| - |
| 246 | S | Phosphorylation |
| - |
| 246 | S | ubiquitylation |
| - |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATF4_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NF2L2_MOUSE | Nfe2l2 | physical | 11274184 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...