| UniProt ID | ATAD1_MOUSE | |
|---|---|---|
| UniProt AC | Q9D5T0 | |
| Protein Name | ATPase family AAA domain-containing protein 1 | |
| Gene Name | Atad1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 361 | |
| Subcellular Localization | Peroxisome . Cell junction, synapse, postsynaptic cell membrane . | |
| Protein Description | ATPase that plays a critical role in regulating the surface expression of AMPA receptors (AMPAR), thereby regulating synaptic plasticity and learning and memory. Required for NMDA-stimulated AMPAR internalization and inhibition of GRIA1 and GRIA2 recycling back to the plasma membrane; these activities are ATPase-dependent.. | |
| Protein Sequence | MVHAEAFSRPLSRNEVVGLIFRLTIFGAVTYFTIKWMVDAIDPTRKQKVEAQKQAEKLMKQIGVKNVKLSEYEMSIAAHLVDPLNMHVTWSDIAGLDDVITDLKDTVILPIKKKHLFENSRLLQPPKGVLLYGPPGCGKTLIAKATAKEAGCRFINLQPSTLTDKWYGESQKLAAAVFSLAIKLQPSIIFIDEIDSFLRNRSSSDHEATAMMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCLD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 137 | Glutathionylation | LLYGPPGCGKTLIAK EEECCCCCCHHHHHH | 6.61 | 24333276 | |
| 137 | S-palmitoylation | LLYGPPGCGKTLIAK EEECCCCCCHHHHHH | 6.61 | 28526873 | |
| 263 | Ubiquitination | HINQPALKQREAILK CCCCHHHHHHHHHHH | 49.79 | 22790023 | |
| 274 | Malonylation | AILKLILKNENVDRH HHHHHHHHCCCCHHH | 56.04 | 26320211 | |
| 274 | Ubiquitination | AILKLILKNENVDRH HHHHHHHHCCCCHHH | 56.04 | - | |
| 314 | Phosphorylation | ALLCVREYVNSTSEE HHHHHHHHHHCCCCC | 8.38 | 25159016 | |
| 317 | Phosphorylation | CVREYVNSTSEESHD HHHHHHHCCCCCCCC | 24.22 | 27087446 | |
| 318 | Phosphorylation | VREYVNSTSEESHDE HHHHHHCCCCCCCCC | 34.65 | 27742792 | |
| 319 | Phosphorylation | REYVNSTSEESHDED HHHHHCCCCCCCCCC | 38.91 | 27742792 | |
| 322 | Phosphorylation | VNSTSEESHDEDEIR HHCCCCCCCCCCCCC | 31.99 | 27087446 | |
| 356 | Phosphorylation | AAFQNVLTHVCLD-- HHHHHHHHHHHCC-- | 14.16 | 30352176 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATAD1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATAD1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATAD1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ATAD1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-322, AND MASSSPECTROMETRY. | |
| "Mitochondrial phosphoproteome revealed by an improved IMAC method andMS/MS/MS."; Lee J., Xu Y., Chen Y., Sprung R., Kim S.C., Xie S., Zhao Y.; Mol. Cell. Proteomics 6:669-676(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-322, AND MASSSPECTROMETRY. | |
