UniProt ID | AT5G2_HUMAN | |
---|---|---|
UniProt AC | Q06055 | |
Protein Name | ATP synthase F(0) complex subunit C2, mitochondrial {ECO:0000305} | |
Gene Name | ATP5MC2 {ECO:0000312|HGNC:HGNC:842} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 141 | |
Subcellular Localization |
Mitochondrion membrane Multi-pass membrane protein. |
|
Protein Description | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element.. | |
Protein Sequence | MFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 (in isoform 3) | Phosphorylation | - | 16.17 | - | |
11 (in isoform 2) | Phosphorylation | - | 20.40 | - | |
13 (in isoform 2) | Phosphorylation | - | 6.23 | - | |
31 | Ubiquitination | PLSAVVLKRPEILTD CCHHHHHCCCCCCCC | 55.06 | 21963094 | |
47 | Ubiquitination | SLSSLAVSCPLTSLV CHHHHHHHCCHHHHH | 12.38 | 21963094 | |
55 | Phosphorylation | CPLTSLVSSRSFQTS CCHHHHHCCCCCCCC | 25.90 | 24719451 | |
70 | Phosphorylation | AISRDIDTAAKFIGA CCCCCHHHHHHHHCC | 28.93 | 26437602 | |
72 | Ubiquitination | SRDIDTAAKFIGAGA CCCHHHHHHHHCCCC | 14.91 | - | |
81 | Phosphorylation | FIGAGAATVGVAGSG HHCCCCCEEECCCCC | 19.77 | 28787133 | |
87 | Phosphorylation | ATVGVAGSGAGIGTV CEEECCCCCCCHHHH | 18.74 | 28787133 | |
88 | Ubiquitination | TVGVAGSGAGIGTVF EEECCCCCCCHHHHH | 27.23 | 21963094 | |
93 | Phosphorylation | GSGAGIGTVFGSLII CCCCCHHHHHHHHHH | 15.67 | 23612710 | |
97 | Phosphorylation | GIGTVFGSLIIGYAR CHHHHHHHHHHHHCC | 12.63 | 28787133 | |
107 | Phosphorylation | IGYARNPSLKQQLFS HHHCCCHHHHHHHHH | 52.31 | 23612710 | |
109 | Methylation | YARNPSLKQQLFSYA HCCCHHHHHHHHHHH | 40.09 | 30530489 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AT5G2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
109 | K | Methylation |
| 30530489 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AT5G2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TYDP2_HUMAN | TDP2 | physical | 21988832 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...