UniProt ID | AT5G1_HUMAN | |
---|---|---|
UniProt AC | P05496 | |
Protein Name | ATP synthase F(0) complex subunit C1, mitochondrial {ECO:0000305} | |
Gene Name | ATP5MC1 {ECO:0000312|HGNC:HGNC:841} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 136 | |
Subcellular Localization |
Mitochondrion membrane Multi-pass membrane protein. |
|
Protein Description | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element.. | |
Protein Sequence | MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | Phosphorylation | VSASFLNSPVNSSKQ CCHHHHCCCCCCCCC | 32.16 | 25627689 | |
38 | Ubiquitination | NSPVNSSKQPSYSNF CCCCCCCCCCCCCCC | 67.08 | - | |
41 | Phosphorylation | VNSSKQPSYSNFPLQ CCCCCCCCCCCCCHH | 38.40 | 24043423 | |
42 | Phosphorylation | NSSKQPSYSNFPLQV CCCCCCCCCCCCHHH | 17.83 | 24043423 | |
43 | Phosphorylation | SSKQPSYSNFPLQVA CCCCCCCCCCCHHHH | 36.01 | 24043423 | |
43 | O-linked_Glycosylation | SSKQPSYSNFPLQVA CCCCCCCCCCCHHHH | 36.01 | OGP | |
65 | Phosphorylation | VVSRDIDTAAKFIGA HHCCCHHHHHHHHCC | 28.93 | 26437602 | |
76 | Phosphorylation | FIGAGAATVGVAGSG HHCCCCCEEECCCCC | 19.77 | 28787133 | |
82 | Phosphorylation | ATVGVAGSGAGIGTV CEEECCCCCCCHHHH | 18.74 | 28787133 | |
88 | Phosphorylation | GSGAGIGTVFGSLII CCCCCHHHHHHHHHH | 15.67 | 23612710 | |
92 | Phosphorylation | GIGTVFGSLIIGYAR CHHHHHHHHHHHHCC | 12.63 | 28787133 | |
102 | Phosphorylation | IGYARNPSLKQQLFS HHHCCCHHHHHHHHH | 52.31 | 23612710 | |
104 | Methylation | YARNPSLKQQLFSYA HCCCHHHHHHHHHHH | 40.09 | 15010464 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AT5G1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
104 | K | Methylation |
| 30530489 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AT5G1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRI69_HUMAN | TRIM69 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...