AT1B3_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AT1B3_RAT
• UniProt AC: Q63377
• Protein Name: Sodium/potassium-transporting ATPase subunit beta-3
• Gene Name: Atp1b3
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 279
• Subcellular Localization: Cell membrane; Single-pass type II membrane protein. Melanosome.
• Protein Description: This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-3 subunit is not known..
• Protein Sequence: MTKTEKKSFHQSLAEWKLFIYNPTSGEFLGRTSKSWGLILLFYLVFYGFLAALFTFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPPTALDYTYSMSDPHTYKKFVEDLKNFLKPYSVEEQKNLTDCPGGALFHQEGPDYSACQFPVSLLQECSGVNDSNFGYSKGQPCVLVKMNRIIELVPDGAPYITCITKEENIANIVTYPDDGLIDLKYFPYYGKKRHVGYRQPLVAVQVIFGADATKKEVTIECQIDGTRNLKNKNERDKFLGRVSFKVIAHA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
124	N-linked_Glycosylation	YSVEEQKNLTDCPGG CCHHHHCCCCCCCCC	48.11	-
158	N-linked_Glycosylation	LQECSGVNDSNFGYS HHHCCCCCCCCCCCC	50.98	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AT1B3_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AT1B3_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AT1B3_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of AT1B3_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.