dbPTM

ASPG1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ASPG1_SCHPO
UniProt AC	P87015
Protein Name	Probable L-asparaginase 1
Gene Name	SPAC186.03
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	360
Subcellular Localization	Secreted, cell wall.
Protein Description
Protein Sequence	MWRSIISFLFFSVALCQPFLFQKRSSNISDFISFNASLPNVTIFAMGGTIAGYASSSTETVDYAAGSVGIATLVDAVPAIKNFSNIRGVQVTNVGSEELTPANVLNLTQLILAEVAKPDVHGIVVTHGTDSLEETAMFLDMTVNTTKPIVVVGAMRPSTAISADGPMNLLNAVVVAASNRSIGRGTMILLNDRIGSAFYTTKTNGNMLDTFKSYEAGFLGMILDQRPHFFYSPATPTGKVHFDVSNTTELPAVEILYGYQGLNPNLAKAAVDLGAKGLVLAGMGAASWTDPGNEVIDGLISNQSIPVVYSHRTMDGFSDYYYNGIPSYFQNPQKARYMLMLSINAGYSIQNITDIFSLEY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
27	N-linked_Glycosylation	LFQKRSSNISDFISF HHCCCCCCHHHHHCC	38.74	-
35	N-linked_Glycosylation	ISDFISFNASLPNVT HHHHHCCCCCCCCEE	23.10	-
40	N-linked_Glycosylation	SFNASLPNVTIFAMG CCCCCCCCEEEEEEC	49.18	-
82	N-linked_Glycosylation	DAVPAIKNFSNIRGV HHHHHHCCCCCCCCE	39.19	-
106	N-linked_Glycosylation	LTPANVLNLTQLILA CCHHHHHCHHHHHHH	36.44	-
144	N-linked_Glycosylation	MFLDMTVNTTKPIVV HHHCCCCCCCCCEEE	32.63	-
179	N-linked_Glycosylation	AVVVAASNRSIGRGT HHHHHCCCCCCCCCC	36.67	-
246	N-linked_Glycosylation	KVHFDVSNTTELPAV EEEEECCCCCCCCEE	51.36	-
302	N-linked_Glycosylation	VIDGLISNQSIPVVY EEEHHHHCCCCCEEE	32.40	-
351	N-linked_Glycosylation	NAGYSIQNITDIFSL CCCCCEECHHHHHCC	37.14	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ASPG1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ASPG1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ASPG1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ASPG1_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ASPG1_SCHPO

Related Literatures of Post-Translational Modification