UniProt ID | ASGL1_HUMAN | |
---|---|---|
UniProt AC | Q7L266 | |
Protein Name | Isoaspartyl peptidase/L-asparaginase | |
Gene Name | ASRGL1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 308 | |
Subcellular Localization | Cytoplasm . Midpiece of sperm tail. | |
Protein Description | Has both L-asparaginase and beta-aspartyl peptidase activity. May be involved in the production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. Is highly active with L-Asp beta-methyl ester. Besides, has catalytic activity toward beta-aspartyl dipeptides and their methyl esters, including beta-L-Asp-L-Phe, beta-L-Asp-L-Phe methyl ester (aspartame), beta-L-Asp-L-Ala, beta-L-Asp-L-Leu and beta-L-Asp-L-Lys. Does not have aspartylglucosaminidase activity and is inactive toward GlcNAc-L-Asn. Likewise, has no activity toward glutamine.. | |
Protein Sequence | MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MNPIVVVH -------CCCEEEEE | 14.02 | 19413330 | |
16 | Phosphorylation | GGGAGPISKDRKERV CCCCCCCCCCHHHHH | 31.47 | 28355574 | |
32 | Phosphorylation | QGMVRAATVGYGILR HHHCHHHHHHHHHHC | 17.30 | 23312004 | |
32 | O-linked_Glycosylation | QGMVRAATVGYGILR HHHCHHHHHHHHHHC | 17.30 | OGP | |
35 | Phosphorylation | VRAATVGYGILREGG CHHHHHHHHHHCCCC | 9.17 | 27642862 | |
103 | Ubiquitination | QCIANPIKLARLVME HHHHCHHHHHHHHHH | 37.03 | - | |
150 | Acetylation | RNKKRLEKEKHEKGA HHHHHHHHHHHHHHC | 76.33 | 24431373 | |
164 | Acetylation | AQKTDCQKNLGTVGA CCCCHHHHHCCCCCE | 61.54 | 25953088 | |
168 | Phosphorylation | DCQKNLGTVGAVALD HHHHHCCCCCEEEEE | 20.94 | 25332170 | |
177 | Ubiquitination | GAVALDCKGNVAYAT CEEEEECCCCEEEEE | 53.86 | - | |
192 | Ubiquitination | STGGIVNKMVGRVGD CCCCCCHHHCCCCCC | 24.86 | - | |
224 | Phosphorylation | STTGHGESILKVNLA ECCCCCHHHEEHHHH | 37.50 | 24719451 | |
243 | Phosphorylation | FHIEQGKTVEEAADL EEECCCCCHHHHHHH | 39.72 | 30177828 | |
251 | Phosphorylation | VEEAADLSLGYMKSR HHHHHHHCHHHHHHH | 21.94 | 27135362 | |
254 | Phosphorylation | AADLSLGYMKSRVKG HHHHCHHHHHHHHCC | 13.48 | 30177828 | |
256 | Ubiquitination | DLSLGYMKSRVKGLG HHCHHHHHHHHCCCC | 26.99 | - | |
269 | Phosphorylation | LGGLIVVSKTGDWVA CCEEEEEECCCCCEE | 17.38 | - | |
282 | Phosphorylation | VAKWTSTSMPWAAAK EEEEEECCCCCEECC | 23.71 | 22210691 | |
289 | Ubiquitination | SMPWAAAKDGKLHFG CCCCEECCCCCEEEE | 63.39 | - | |
292 | Ubiquitination | WAAAKDGKLHFGIDP CEECCCCCEEEEECC | 49.26 | - | |
305 | Phosphorylation | DPDDTTITDLP---- CCCCCCCCCCC---- | 29.41 | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ASGL1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ASGL1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ASGL1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ASGL1_HUMAN !! |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. |