ASCL4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ASCL4_HUMAN
• UniProt AC: Q6XD76
• Protein Name: Achaete-scute homolog 4
• Gene Name: ASCL4
• Organism: Homo sapiens (Human).
• Sequence Length: 172
• Subcellular Localization: Nucleus .
• Protein Description: Could be a transcriptional regulator involved in skin development..
• Protein Sequence: METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFEPAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLERQAWGLEGAAGAVPQRRAECNSDGESKASSAPSPSSEPEEGGS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	ERLALPYSLRTAPLG HHHCCCCCCCCCCCC	14.94	24719451
162	Phosphorylation	SKASSAPSPSSEPEE CCCCCCCCCCCCCCC	36.81	22468782

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ASCL4_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ASCL4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ASCL4_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of ASCL4_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.