UniProt ID | AS3MT_MOUSE | |
---|---|---|
UniProt AC | Q91WU5 | |
Protein Name | Arsenite methyltransferase | |
Gene Name | As3mt | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 376 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Catalyzes the transfer of a methyl group from AdoMet to trivalent arsenicals producing methylated and dimethylated arsenicals. It methylates arsenite to form methylarsonate, Me-AsO(3)H(2), which is reduced by methylarsonate reductase to methylarsonite, Me-As(OH)2. Methylarsonite is also a substrate and it is converted into the much less toxic compound dimethylarsinate (cacodylate), Me(2)As(O)-OH (By similarity).. | |
Protein Sequence | MAASRDADEIHKDVQNYYGNVLKTSADLQTNACVTRAKPVPSYIRESLQNVHEDVSSRYYGCGLTVPERLENCRILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTEVQVEVAKTYLEHHMEKFGFQAPNVTFLHGRIEKLAEAGIQSESYDIVISNCVINLVPDKQQVLQEVYRVLKHGGELYFSDVYASLEVPEDIKSHKVLWGECLGGALYWKDLAIIAQKIGFCPPRLVTADIITVENKELEGVLGDCRFVSATFRLFKLPKTEPAERCRVVYNGGIKGHEKELIFDANFTFKEGEAVAVDEETAAVLKNSRFAPDFLFTPVDASLPAPQGRSELETKVLIRDPFKLAEDSDKMKPRHAPEGTGGCCGKRKNC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Ubiquitination | RDADEIHKDVQNYYG CCHHHHHHHHHHHHH | 66.32 | 22790023 | |
33 | S-nitrosocysteine | ADLQTNACVTRAKPV CCCCCCCCCCCCCCC | 3.31 | - | |
33 | S-nitrosylation | ADLQTNACVTRAKPV CCCCCCCCCCCCCCC | 3.31 | 21278135 | |
38 | Ubiquitination | NACVTRAKPVPSYIR CCCCCCCCCCCHHHH | 43.17 | 27667366 | |
47 | Phosphorylation | VPSYIRESLQNVHED CCHHHHHHHHHHCCC | 25.96 | - | |
62 | S-palmitoylation | VSSRYYGCGLTVPER HHHCCCCCCCCHHHH | 2.03 | 28526873 | |
213 | Phosphorylation | ECLGGALYWKDLAII HHHHHHHHHHHHHHH | 15.18 | 20469934 | |
251 | S-palmitoylation | LEGVLGDCRFVSATF ECCHHCCCCEEEEEE | 3.27 | 28526873 | |
336 | Phosphorylation | LPAPQGRSELETKVL CCCCCCCCHHCEEEE | 54.05 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AS3MT_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AS3MT_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AS3MT_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AS3MT_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...