| UniProt ID | ARY1_HUMAN | |
|---|---|---|
| UniProt AC | P18440 | |
| Protein Name | Arylamine N-acetyltransferase 1 | |
| Gene Name | NAT1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 290 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.. | |
| Protein Sequence | MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MDIEAYLE -------CCHHHHHH | 12.06 | 22814378 | |
| 12 | Phosphorylation | AYLERIGYKKSRNKL HHHHHHCCCCCCCCC | 16.93 | 29116813 | |
| 18 | Ubiquitination | GYKKSRNKLDLETLT CCCCCCCCCCHHHHH | 42.12 | - | |
| 25 | Phosphorylation | KLDLETLTDILQHQI CCCHHHHHHHHHHHH | 28.54 | 18452278 | |
| 68 | Acetylation | RRNRGGWCLQVNHLL HHCCCCEEEEHHHHH | 1.84 | 15039438 | |
| 101 | Phosphorylation | YSTPAKKYSTGMIHL EECCCCCCCCCCEEE | 15.68 | 22817900 | |
| 185 | Ubiquitination | SDLLEDSKYRKIYSF CHHCCCCCCCEEEEE | 62.49 | - | |
| 188 | Ubiquitination | LEDSKYRKIYSFTLK CCCCCCCEEEEEEEC | 42.79 | - | |
| 191 | Phosphorylation | SKYRKIYSFTLKPRT CCCCEEEEEEECCCC | 18.41 | 27251275 | |
| 204 | Phosphorylation | RTIEDFESMNTYLQT CCHHHHHHHHHHCCC | 19.82 | 27251275 | |
| 208 | Phosphorylation | DFESMNTYLQTSPSS HHHHHHHHCCCCCCC | 7.57 | - | |
| 214 | Phosphorylation | TYLQTSPSSVFTSKS HHCCCCCCCCCCCCC | 38.61 | 28348404 | |
| 215 | Phosphorylation | YLQTSPSSVFTSKSF HCCCCCCCCCCCCCC | 25.32 | 24719451 | |
| 219 | Phosphorylation | SPSSVFTSKSFCSLQ CCCCCCCCCCCEECC | 18.16 | 27251275 | |
| 221 | Phosphorylation | SSVFTSKSFCSLQTP CCCCCCCCCEECCCC | 31.11 | 27251275 | |
| 227 | Phosphorylation | KSFCSLQTPDGVHCL CCCEECCCCCCCEEE | 28.74 | 24719451 | |
| 247 | Ubiquitination | THRRFNYKDNTDLIE EEECCCCCCCCCEEE | 45.68 | - | |
| 256 | Ubiquitination | NTDLIEFKTLSEEEI CCCEEEEEECCHHHH | 35.45 | - | |
| 259 | Phosphorylation | LIEFKTLSEEEIEKV EEEEEECCHHHHHHH | 48.47 | 22985185 | |
| 265 | Ubiquitination | LSEEEIEKVLKNIFN CCHHHHHHHHHHHHC | 59.54 | - | |
| 274 | Phosphorylation | LKNIFNISLQRKLVP HHHHHCHHHHHHCCC | 21.39 | 27067055 | |
| 289 | Phosphorylation | KHGDRFFTI------ CCCCCCCCC------ | 24.06 | 27251275 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARY1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARY1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARY1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ICAM1_HUMAN | ICAM1 | physical | 26186194 | |
| ICAM1_HUMAN | ICAM1 | physical | 28514442 |
| Kegg Disease | |
|---|---|
| There are no disease associations of PTM sites. | |
| OMIM Disease | |
| There are no disease associations of PTM sites. | |
| Kegg Drug | |
| There are no disease associations of PTM sites. | |
| DrugBank | |
| DB01015 | Sulfamethoxazole |
loading...
