UniProt ID | ARRD5_HUMAN | |
---|---|---|
UniProt AC | A6NEK1 | |
Protein Name | Arrestin domain-containing protein 5 | |
Gene Name | ARRDC5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 342 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MGDREECLSTPQPPMSVVKSIELVLPEDRIYLAGSSIKGQVILTLNSTLVDPIVKVELVGRGYVEWSEEAGASCDYSRNVICNNKADYVHKTKTFPVEDNWLSAGSHTFDFHFNLPPRLPSTFTSKFGHVFYFVQASCMGREHILAKKRMYLLVQGTSTFHKETPFQNPLFVEAEEKVSYNCCRQGTVCLQIQMERNTFTPGEKVVFTTEINNQTSKCIKTVVFALYAHIQYEGFTPSAERRSRLDSSELLRQEANTPVTRFNTTKVVSTFNLPLLLSVSSSTQDGEIMHTRYELVTTVHLPWSLTSLKAKVPIIITSASVDSAICQLSEDGVLPVNPDHQN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | STPQPPMSVVKSIEL CCCCCCCCHHEEEEE | 29.54 | 18452278 | |
282 | Phosphorylation | LLLSVSSSTQDGEIM EEEEECCCCCCCCEE | 23.68 | - | |
283 | Phosphorylation | LLSVSSSTQDGEIMH EEEECCCCCCCCEEE | 32.40 | - | |
317 | Phosphorylation | AKVPIIITSASVDSA CCCCEEEEECCCCHH | 14.08 | 24719451 | |
318 | Phosphorylation | KVPIIITSASVDSAI CCCEEEEECCCCHHH | 14.24 | 24719451 | |
323 | Phosphorylation | ITSASVDSAICQLSE EEECCCCHHHHCCCC | 19.85 | 25693802 | |
329 | Phosphorylation | DSAICQLSEDGVLPV CHHHHCCCCCCCCCC | 14.04 | 25693802 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARRD5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARRD5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARRD5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARRD5_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...