| UniProt ID | ARPIN_HUMAN | |
|---|---|---|
| UniProt AC | Q7Z6K5 | |
| Protein Name | Arpin | |
| Gene Name | ARPIN | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 226 | |
| Subcellular Localization | Cell projection, lamellipodium. Colocalized with the WAVE complex at lamelliupodium tip.. | |
| Protein Description | Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competetive with nucleation promoting factors. Participates in an incoherent feedforward loop at the lamellipodium tip where it inhibits the ARP2/2 complex in response to Rac signaling and where Rac also stimulates actin polymerization through the WAVE complex. Involved in steering cell migration by controlling its directional persistence.. | |
| Protein Sequence | MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIHRRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAFWMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWDD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSRIYHDGA ------CCCCCCCHH | 25159151 | ||
| 3 | Methylation | -----MSRIYHDGAL -----CCCCCCCHHH | - | ||
| 5 | Phosphorylation | ---MSRIYHDGALRN ---CCCCCCCHHHCC | 25159151 | ||
| 13 | Acetylation | HDGALRNKAVQSVRL CCHHHCCCCCCEEEC | 25953088 | ||
| 48 | Phosphorylation | LIDVSRHSILDTHGR EEECCCCEEECCCCC | 22985185 | ||
| 77 | Ubiquitination | HRRKFDAKGNEIEPN CCCCCCCCCCCCCCC | - | ||
| 77 | Acetylation | HRRKFDAKGNEIEPN CCCCCCCCCCCCCCC | 22424773 | ||
| 86 | Phosphorylation | NEIEPNFSATRKVNT CCCCCCCEEECEECC | 28348404 | ||
| 88 | Phosphorylation | IEPNFSATRKVNTGF CCCCCEEECEECCCE | 28348404 | ||
| 93 | Phosphorylation | SATRKVNTGFLMSSY EEECEECCCEEEEEE | 29214152 | ||
| 98 | Phosphorylation | VNTGFLMSSYKVEAK ECCCEEEEEEEEEEC | 23403867 | ||
| 99 | Phosphorylation | NTGFLMSSYKVEAKG CCCEEEEEEEEEECC | 23403867 | ||
| 100 | Phosphorylation | TGFLMSSYKVEAKGD CCEEEEEEEEEECCC | 23403867 | ||
| 101 | Ubiquitination | GFLMSSYKVEAKGDT CEEEEEEEEEECCCC | 21890473 | ||
| 108 | Phosphorylation | KVEAKGDTDRLTPEA EEEECCCCCCCCHHH | 23186163 | ||
| 112 | Phosphorylation | KGDTDRLTPEALKGL CCCCCCCCHHHHHHH | 22985185 | ||
| 182 | Ubiquitination | LEAGTVTKCNFTGDG EECCEEEEEEECCCC | - | ||
| 194 | Phosphorylation | GDGKTGASWTDNIMA CCCCCCCCCCHHHHC | 28348404 | ||
| 203 | Ubiquitination | TDNIMAQKCSKGAAA CHHHHCHHCCCCCHH | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARPIN_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARPIN_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARPIN_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ARPIN_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
