| UniProt ID | ARPC5_RAT | |
|---|---|---|
| UniProt AC | Q4KLF8 | |
| Protein Name | Actin-related protein 2/3 complex subunit 5 | |
| Gene Name | Arpc5 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 151 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. Cell projection. | |
| Protein Description | Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.. | |
| Protein Sequence | MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSKNTVSSA ------CCCCCCCCC | 34.31 | - | |
| 7 | Phosphorylation | -MSKNTVSSARFRKV -CCCCCCCCCCEEEC | 19.08 | 23984901 | |
| 8 | Phosphorylation | MSKNTVSSARFRKVD CCCCCCCCCCEEECC | 21.08 | 23984901 | |
| 13 | Acetylation | VSSARFRKVDVDEYD CCCCCEEECCHHHCC | 39.82 | 22902405 | |
| 13 | Succinylation | VSSARFRKVDVDEYD CCCCCEEECCHHHCC | 39.82 | 26843850 | |
| 77 | Phosphorylation | AVKDRAGSIVLKVLI HHHHHHHHHHHHHHH | 14.45 | 28432305 | |
| 93 | Acetylation | FKANDIEKAVQSLDK CHHCHHHHHHHHHHH | 54.94 | 22902405 | |
| 140 | Phosphorylation | LAAGGVGSIVRVLTA HHCCCHHHHHHHHHC | 18.59 | 23984901 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARPC5_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARPC5_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARPC5_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ARPC5_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
