ARPC4_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARPC4_CAEEL
• UniProt AC: P58798
• Protein Name: Probable actin-related protein 2/3 complex subunit 4
• Gene Name: arx-6
• Organism: Caenorhabditis elegans.
• Sequence Length: 169
• Subcellular Localization: Cytoplasm, cytoskeleton.
• Protein Description: Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the mother actin filament (By similarity)..
• Protein Sequence: MSATLQPYLEAVRHTLQAALCLEQFSSQVVERHNKPEVEVQTSKELLMTPVVVARNKQERVLIEPSVNSVRISIAIKQSDEIEKILCHKFTRFMCQRADNFFVLRRKPLPGYDISFLITASHTEAMFKHKLVDFLLHFMQEIDKEISEMKLSLNARARVSAEEFLKRFN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSATLQPYL ------CCCCHHHHH	29.93	28854356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARPC4_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARPC4_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARPC4_CAEEL !!

Protein-Protein Interaction

Oops, there are no PPI records of ARPC4_CAEEL !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.