UniProt ID | ARPC4_CAEEL | |
---|---|---|
UniProt AC | P58798 | |
Protein Name | Probable actin-related protein 2/3 complex subunit 4 | |
Gene Name | arx-6 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 169 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the mother actin filament (By similarity).. | |
Protein Sequence | MSATLQPYLEAVRHTLQAALCLEQFSSQVVERHNKPEVEVQTSKELLMTPVVVARNKQERVLIEPSVNSVRISIAIKQSDEIEKILCHKFTRFMCQRADNFFVLRRKPLPGYDISFLITASHTEAMFKHKLVDFLLHFMQEIDKEISEMKLSLNARARVSAEEFLKRFN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSATLQPYL ------CCCCHHHHH | 29.93 | 28854356 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARPC4_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARPC4_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARPC4_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARPC4_CAEEL !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...