| UniProt ID | ARPC3_MOUSE | |
|---|---|---|
| UniProt AC | Q9JM76 | |
| Protein Name | Actin-related protein 2/3 complex subunit 3 | |
| Gene Name | Arpc3 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 178 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. Cell projection. | |
| Protein Description | Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.. | |
| Protein Sequence | MPAYHSSLMDPDTKLIGNMALLPLRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPASKQEDEMMRAYLQQLRQETGLRLCEKVFDPQSDKPSKWWTCFVKRQFMNKSLSGPGQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MPAYHSSLMDPDT --CCCCCCCCCCCCC | 16.70 | 21183079 | |
| 7 | Phosphorylation | -MPAYHSSLMDPDTK -CCCCCCCCCCCCCC | 17.88 | 21183079 | |
| 14 | Ubiquitination | SLMDPDTKLIGNMAL CCCCCCCCEECCEEH | 45.55 | 22790023 | |
| 29 | Succinylation | LPLRSQFKGPAPRET HHHHHCCCCCCCCCC | 57.24 | 23954790 | |
| 29 | Acetylation | LPLRSQFKGPAPRET HHHHHCCCCCCCCCC | 57.24 | 22826441 | |
| 29 | Malonylation | LPLRSQFKGPAPRET HHHHHCCCCCCCCCC | 57.24 | 26320211 | |
| 29 | Ubiquitination | LPLRSQFKGPAPRET HHHHHCCCCCCCCCC | 57.24 | 27667366 | |
| 36 | Phosphorylation | KGPAPRETKDTDIVD CCCCCCCCCCCCHHH | 35.18 | 25367039 | |
| 37 | Ubiquitination | GPAPRETKDTDIVDE CCCCCCCCCCCHHHH | 54.61 | 22790023 | |
| 39 | Phosphorylation | APRETKDTDIVDEAI CCCCCCCCCHHHHHH | 29.22 | 25367039 | |
| 47 | Phosphorylation | DIVDEAIYYFKANVF CHHHHHHHHHHHCEE | 15.19 | 25177544 | |
| 48 | Phosphorylation | IVDEAIYYFKANVFF HHHHHHHHHHHCEEE | 7.78 | 25367039 | |
| 56 | Acetylation | FKANVFFKNYEIKNE HHHCEEEECCEECCH | 47.34 | 22826441 | |
| 56 | Succinylation | FKANVFFKNYEIKNE HHHCEEEECCEECCH | 47.34 | 23954790 | |
| 61 | Ubiquitination | FFKNYEIKNEADRTL EEECCEECCHHHHHH | 36.47 | 27667366 | |
| 61 | Acetylation | FFKNYEIKNEADRTL EEECCEECCHHHHHH | 36.47 | 22826441 | |
| 61 | Succinylation | FFKNYEIKNEADRTL EEECCEECCHHHHHH | 36.47 | 23954790 | |
| 123 | Ubiquitination | IYAKPASKQEDEMMR EEECCCCHHHHHHHH | 60.87 | 27667366 | |
| 147 | Acetylation | TGLRLCEKVFDPQSD HCCHHHHHHCCCCCC | 47.40 | 22826441 | |
| 155 | Acetylation | VFDPQSDKPSKWWTC HCCCCCCCCCCCEEE | 57.34 | 23954790 | |
| 158 | Acetylation | PQSDKPSKWWTCFVK CCCCCCCCCEEEEHH | 56.10 | 22826441 | |
| 165 | Acetylation | KWWTCFVKRQFMNKS CCEEEEHHHHHHCHH | 21.89 | 22826441 | |
| 171 | Acetylation | VKRQFMNKSLSGPGQ HHHHHHCHHCCCCCC | 40.77 | 22826441 | |
| 174 | Phosphorylation | QFMNKSLSGPGQ--- HHHCHHCCCCCC--- | 50.46 | 30635358 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARPC3_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARPC3_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARPC3_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ARPC3_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative time-resolved phosphoproteomic analysis of mast cellsignaling."; Cao L., Yu K., Banh C., Nguyen V., Ritz A., Raphael B.J., Kawakami Y.,Kawakami T., Salomon A.R.; J. Immunol. 179:5864-5876(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-47, AND MASSSPECTROMETRY. | |