| UniProt ID | ARPC2_MOUSE | |
|---|---|---|
| UniProt AC | Q9CVB6 | |
| Protein Name | Actin-related protein 2/3 complex subunit 2 | |
| Gene Name | Arpc2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 300 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. Cell projection. Cell junction, synapse, synaptosome . | |
| Protein Description | Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the mother actin filament (By similarity).. | |
| Protein Sequence | MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPEPGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNATARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 65 | Acetylation | SISLKFYKELQAHGA EEEHHHHHHHHHCCH | 55.89 | 23864654 | |
| 65 | Ubiquitination | SISLKFYKELQAHGA EEEHHHHHHHHHCCH | 55.89 | - | |
| 77 | Acetylation | HGADELLKRVYGSFL CCHHHHHHHHHHHHH | 53.06 | 23954790 | |
| 108 | Phosphorylation | NLPASKDSIVHQAGM CCCCCCCHHHHHHHH | 30.19 | 22802335 | |
| 136 | Acetylation | FQFQEEGKEGENRAV HHHHHCCCCCCCEEE | 66.86 | 22826441 | |
| 136 | Ubiquitination | FQFQEEGKEGENRAV HHHHHCCCCCCCEEE | 66.86 | - | |
| 186 | Acetylation | KVFMQEFKEGRRASH EHHHHHHHCCCCCCC | 59.51 | 22826441 | |
| 186 | Malonylation | KVFMQEFKEGRRASH EHHHHHHHCCCCCCC | 59.51 | 26320211 | |
| 192 | Phosphorylation | FKEGRRASHTAPQVL HHCCCCCCCCCCCHH | 21.40 | 28833060 | |
| 240 | Phosphorylation | NATARDNTINLIHTF CCCCCCCEEEHHHHH | 18.61 | 26370283 | |
| 257 | Glutathionylation | YLHYHIKCSKAYIHT HHHHHHEECCCCHHH | 5.09 | 24333276 | |
| 261 | Phosphorylation | HIKCSKAYIHTRMRA HHEECCCCHHHHHHH | 9.29 | 25367039 | |
| 275 | Ubiquitination | AKTSDFLKVLNRARP HCHHHHHHHHHHHCC | 44.67 | - | |
| 275 | Malonylation | AKTSDFLKVLNRARP HCHHHHHHHHHHHCC | 44.67 | 26320211 | |
| 275 | Acetylation | AKTSDFLKVLNRARP HCHHHHHHHHHHHCC | 44.67 | 22826441 | |
| 290 | Ubiquitination | DAEKKEMKTITGKTF CHHHHHHHHHCCCCC | 37.56 | 27667366 | |
| 290 | Malonylation | DAEKKEMKTITGKTF CHHHHHHHHHCCCCC | 37.56 | 26320211 | |
| 290 | Acetylation | DAEKKEMKTITGKTF CHHHHHHHHHCCCCC | 37.56 | 22902405 | |
| 295 | Ubiquitination | EMKTITGKTFSSR-- HHHHHCCCCCCCC-- | 37.43 | 27667366 | |
| 295 | Acetylation | EMKTITGKTFSSR-- HHHHHCCCCCCCC-- | 37.43 | - | |
| 296 | Phosphorylation | MKTITGKTFSSR--- HHHHCCCCCCCC--- | 30.05 | 29176673 | |
| 298 | Phosphorylation | TITGKTFSSR----- HHCCCCCCCC----- | 30.36 | 29514104 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARPC2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARPC2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARPC2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ARPC2_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...