UniProt ID | ARP5L_MOUSE | |
---|---|---|
UniProt AC | Q9D898 | |
Protein Name | Actin-related protein 2/3 complex subunit 5-like protein | |
Gene Name | Arpc5l | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 153 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | May function as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.. | |
Protein Sequence | MARNTLSSRFRRVDIDEFDENKFVDEHEEAAAAAGEPGPDPCEVDGLLRQGDMLRAFHAALRNSPINTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGIDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MARNTLSSRFRR ---CCCCHHHHHHHC | 23.59 | 23737553 | |
7 | Phosphorylation | -MARNTLSSRFRRVD -CCCCHHHHHHHCCC | 19.89 | 23737553 | |
8 | Phosphorylation | MARNTLSSRFRRVDI CCCCHHHHHHHCCCH | 38.25 | 23737553 | |
17 | Ubiquitination | FRRVDIDEFDENKFV HHCCCHHHCCCCCCC | 56.16 | 27667366 | |
64 | Phosphorylation | FHAALRNSPINTKNQ HHHHHHCCCCCCCCH | 22.26 | 25521595 | |
68 | Phosphorylation | LRNSPINTKNQAVKE HHCCCCCCCCHHHHH | 31.90 | 25159016 | |
69 | Ubiquitination | RNSPINTKNQAVKER HCCCCCCCCHHHHHH | 42.44 | 27667366 | |
69 | Malonylation | RNSPINTKNQAVKER HCCCCCCCCHHHHHH | 42.44 | 26320211 | |
86 | Phosphorylation | GVVLKVLTNFKSSEI HHHHHHHHHCCHHHH | 41.41 | 20415495 | |
89 | Ubiquitination | LKVLTNFKSSEIEQA HHHHHHCCHHHHHHH | 55.96 | - | |
90 | Phosphorylation | KVLTNFKSSEIEQAV HHHHHCCHHHHHHHH | 29.12 | 25521595 | |
91 | Phosphorylation | VLTNFKSSEIEQAVQ HHHHCCHHHHHHHHH | 43.09 | 29472430 | |
110 | Ubiquitination | NGIDLLMKYIYKGFE CCHHHHHHHHHHCCC | 28.59 | - | |
148 | Phosphorylation | GSIIRVLTARKTV-- HHHHHHHHHCCCC-- | 22.89 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARP5L_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARP5L_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARP5L_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARP5L_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...