| UniProt ID | ARP3C_HUMAN | |
|---|---|---|
| UniProt AC | Q9C0K3 | |
| Protein Name | Actin-related protein 3C | |
| Gene Name | ACTR3C | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 210 | |
| Subcellular Localization | ||
| Protein Description | May play a role in the suppression of metastatic potential in lung adenoma carcinoma cells.. | |
| Protein Sequence | MFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPQKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDSMESISDVVDEVIQNCPIDVRRPLYKMEQIPLSYPQGHGFHPLSPPFH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MFESFNVPGLY ----CCCCCCCCHHH | 15.74 | - | |
| 11 | Phosphorylation | SFNVPGLYIAVQAVL CCCCCHHHHHHHHHH | 7.86 | - | |
| 23 | Phosphorylation | AVLALAASWTSRQVG HHHHHHHHHHCCCCC | 25.86 | - | |
| 55 | Phosphorylation | VIPVAEGYVIGSCIK EEEECCCEEEHHHHH | 4.76 | 20090780 | |
| 59 | Phosphorylation | AEGYVIGSCIKHIPI CCCEEEHHHHHCCCC | 11.09 | - | |
| 72 | Phosphorylation | PIAGRDITYFIQQLL CCCCCHHHHHHHHHH | 19.37 | 28450419 | |
| 73 | Phosphorylation | IAGRDITYFIQQLLR CCCCHHHHHHHHHHH | 10.06 | 28450419 | |
| 101 | Ubiquitination | TAKAIKEKYCYICPD HHHHHHHHHEEECHH | 35.30 | 29967540 | |
| 102 | Phosphorylation | AKAIKEKYCYICPDI HHHHHHHHEEECHHH | 7.50 | 21082442 | |
| 115 | Ubiquitination | DIVKEFAKYDVDPQK HHHHHHHCCCCCHHH | 47.51 | 29967540 | |
| 125 | Ubiquitination | VDPQKWIKQYTGINA CCHHHHHHHHHCCCC | 35.82 | - | |
| 127 | Phosphorylation | PQKWIKQYTGINAIN HHHHHHHHHCCCCCC | 11.26 | 21403953 | |
| 136 | Ubiquitination | GINAINQKKFVIDVG CCCCCCCCEEEEEEC | 43.63 | 27667366 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARP3C_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARP3C_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARP3C_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ARP3C_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
